PDB entry 4eyw

View 4eyw on RCSB PDB site
Description: Crystal structure of rat carnitine palmitoyltransferase 2 in complex with 1-[(R)-2-(3,4-Dihydro-1H-isoquinoline-2-carbonyl)-piperidin-1-yl]-2-phenoxy-ethanone
Class: Transferase/Transferase Inhibitor
Keywords: ACYLTRANSFERASE, MITOCHONDRIAL PROTEIN, Transferase-Transferase Inhibitor complex
Deposited on 2012-05-02, released 2013-04-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carnitine O-palmitoyltransferase 2, mitochondrial
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Cpt2, Cpt-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4eywa1
  • Chain 'B':
    Compound: Carnitine O-palmitoyltransferase 2, mitochondrial
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Cpt2, Cpt-2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18886 (2-633)
      • expression tag (0-1)
  • Heterogens: L0R, P6G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4eywA (A:)
    hmavsgpddylqhsivptmhyqdslprlpipkledtmkrylnaqkpllddsqfrrtealc
    knfetgvgkelhahllaqdkqnkhtsyisgpwfdmyltardsivlnfnpfmafnpdpkse
    yndqltratnltvsavrflktlqagllepevfhlnpsksdtdafkrlirfvppslswyga
    ylvnaypldmsqyfrlfnstriprpnrdelftdtkarhllvlrkghfyvfdvldqdgniv
    npleiqahlkyilsdsspvpefpvayltsenrdvwaelrqklifdgneetlkkvdsavfc
    lclddfpmkdlihlshtmlhgdgtnrwfdksfnlivaedgtaavhfehswgdgvavlrff
    nevfrdstqtpaitpqsqpaatnssasvetlsfnlsgalkagitaakekfdttvktlsid
    siqfqrggkeflkkkqlspdavaqlafqmaflrqygqtvatyescstaafkhgrtetirp
    asiftkrcseafvrdpskhsvgelqhmmaecskyhgqltkeaamgqgfdrhlyalrylat
    arglnlpelyldpayqqmnhnilststlnspavslggfapvvpdgfgiayavhddwigcn
    vssysgrnareflhcvqkcledifdalegkaikt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eywA (A:)
    ddylqhsivptmhyqdslprlpipkledtmkrylnaqkpllddsqfrrtealcknfetgv
    gkelhahllaqdkqnkhtsyisgpwfdmyltardsivlnfnpfmafnpdpkseyndqltr
    atnltvsavrflktlqagllepevfhlnpsksdtdafkrlirfvppslswygaylvnayp
    ldmsqyfrlfnstriprpnrdelftdtkarhllvlrkghfyvfdvldqdgnivnpleiqa
    hlkyilsdsspvpefpvayltsenrdvwaelrqklifdgneetlkkvdsavfclclddfp
    mkdlihlshtmlhgdgtnrwfdksfnlivaedgtaavhfehswgdgvavlrffnevfrds
    tqtpaitpqsqpaatnssasvetlsfnlsgalkagitaakekfdttvktlsidsiqfqrg
    gkeflkkkqlspdavaqlafqmaflrqygqtvatyescstaafkhgrtetirpasiftkr
    cseafvrdpskhsvgelqhmmaecskyhgqltkeaamgqgfdrhlyalrylatarglnlp
    elyldpayqqmnhnilststlnspavslggfapvvpdgfgiayavhddwigcnvssysgr
    nareflhcvqkcledifdalegkaikt
    

  • Chain 'B':
    No sequence available.