PDB entry 4eyj

View 4eyj on RCSB PDB site
Description: MAPK13 Complex with inhibitor
Class: Transferase/Transferase Inhibitor
Keywords: p38 family kinase, map kinase, Transferase-Transferase Inhibitor complex
Deposited on 2012-05-01, released 2012-12-19
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-12-19, with a file datestamp of 2012-12-14.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.244
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 13
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK13, PRKM13, SAPK4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4eyja_
  • Heterogens: N61, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4eyjA (A:)
    mgsshhhhhhssglvprgsmslirkkgfykqdvnktawelpktyvspthvgsgaygsvcs
    aidkrsgekvaikklsrpfqseifakrayrellllkhmqhenviglldvftpasslrnfy
    dfylvmpfmqtdlqkimgmefseekiqylvyqmlkglkyihsagvvhrdlkpgnlavned
    celkildfglarhadaemtgyvvtrwyrapevilswmhynqtvdiwsvgcimaemltgkt
    lfkgkdyldqltqilkvtgvpgtefvqklndkaaksyiqslpqtprkdftqlfpraspqa
    adllekmleldvdkrltaaqalthpffepfrdpeeeteaqqpfddslehekltvdewkqh
    iykeivnfspi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eyjA (A:)
    slirkkgfykqdvnktawelpktyvspthvgsgaygsvcsaidkrsgekvaikklsrpfq
    seifakrayrellllkhmqhenviglldvftpasslrnfydfylvmpfmqtdlqkimgme
    fseekiqylvyqmlkglkyihsagvvhrdlkpgnlavnedcelkildfglvtrwyrapev
    ilswmhynqtvdiwsvgcimaemltgktlfkgkdyldqltqilkvtgvpgtefvqklndk
    aaksyiqslpqtprkdftqlfpraspqaadllekmleldvdkrltaaqalthpffepfrd
    peeeteaqqpfddslehekltvdewkqhiykeivnfsp