PDB entry 4ey2

View 4ey2 on RCSB PDB site
Description: Crystal structure of NDM-1 bound to hydrolyzed methicillin
Class: Hydrolase/antibiotic
Keywords: Metallo-Beta-Lactamase, antibiotic, Hydrolase-antibiotic complex
Deposited on 2012-05-01, released 2012-08-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.17 Å
R-factor: N/A
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase NDM-1
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: blaNDM-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4ey2a_
  • Chain 'B':
    Compound: Beta-lactamase NDM-1
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: blaNDM-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4ey2b_
  • Heterogens: 0RM, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ey2A (A:)
    melpnimhpvaklstalaaalmlsgcmpgeirptigqqmetgdqrfgdlvfrqlapnvwq
    htsyldmpgfgavasnglivrdggrvlvvdtawtddqtaqilnwikqeinlpvalavvth
    ahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhsltfaangwvepatapnfgpl
    kvfypgpghtsdnitvgidgtdiafggclikdskakslgnlgdadtehyaasarafgaaf
    pkasmivmshsapdsraaithtarmadklr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ey2A (A:)
    eirptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvv
    dtawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqla
    pqegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggcl
    ikdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadkl
    r
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ey2B (B:)
    melpnimhpvaklstalaaalmlsgcmpgeirptigqqmetgdqrfgdlvfrqlapnvwq
    htsyldmpgfgavasnglivrdggrvlvvdtawtddqtaqilnwikqeinlpvalavvth
    ahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhsltfaangwvepatapnfgpl
    kvfypgpghtsdnitvgidgtdiafggclikdskakslgnlgdadtehyaasarafgaaf
    pkasmivmshsapdsraaithtarmadklr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ey2B (B:)
    eirptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvv
    dtawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqla
    pqegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggcl
    ikdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadkl
    r