PDB entry 4exz

View 4exz on RCSB PDB site
Description: Crystal Structure of the Q108K:K40L Mutant of Cellular Retinol Binding Protein Type II in Complex with All-trans-Retinal at 1.7 Angstrom Resolution
Class: transport protein
Keywords: retinal complex, beta barrel, TRANSPORT PROTEIN
Deposited on 2012-05-01, released 2012-12-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-12-26, with a file datestamp of 2012-12-21.
Experiment type: XRAY
Resolution: 1.61 Å
R-factor: 0.215
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Retinol-binding protein 2
  Species: Homo sapiens [TaxId:9606]
  Gene: RBP2, CRBP2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P50120 (0-132)
    • engineered mutation (39)
    • engineered mutation (107)
    • conflict (112)
  Domains in SCOPe 2.07: d4exza_
• Chain 'B':
  Compound: Retinol-binding protein 2
  Species: Homo sapiens [TaxId:9606]
  Gene: RBP2, CRBP2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P50120 (0-132)
    • engineered mutation (39)
    • engineered mutation (107)
    • conflict (112)
  Domains in SCOPe 2.07: d4exzb_
• Heterogens: ACT, RET, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4exzA (A:)
  trdqngtwemesnenfegymkaldidfatrkiavrltqtlvidqdgdnfktkttstfrny
  dvdftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkkwiegnklylelt
  cgdqvcrqvfkkk
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4exzB (B:)
  trdqngtwemesnenfegymkaldidfatrkiavrltqtlvidqdgdnfktkttstfrny
  dvdftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkkwiegnklylelt
  cgdqvcrqvfkkk