PDB entry 4ewq

View 4ewq on RCSB PDB site
Description: Human p38 alpha MAPK in complex with a pyridazine based inhibitor
Class: transferase/transferase inhibitor
Keywords: Serine/Threonine-protein kinase, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, Protein Kinase Domain, Transferase, ATP Binding, Phosphorylation, Cytosol, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-04-27, released 2012-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-06-27, with a file datestamp of 2012-06-22.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.182
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2, SAPK2A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ewqa_
  • Heterogens: GG5, MWL, ZN, CL, BME, GOL, ACT, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ewqA (A:)
    mhhhhhhssgvdlgtenlyfqsnasqerptfyrqelnktiwevperyqnlspvgsgaygs
    vcaafdtktglrvavkklsrpfqsiihakrtyrelrllkhmkhenviglldvftparsle
    efndvylvthlmgadlnnivkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnla
    vnedcelkildfglarhtddemtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaell
    tgrtlfpgtdhidqlklilrlvgtpgaellkkissesarnyiqsltqmpkmnfanvfiga
    nplavdllekmlvldsdkritaaqalahayfaqyhdpddepvadpydqsfesrdllidew
    ksltydevisfvpppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ewqA (A:)
    rptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsiih
    akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltd
    dhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfarhtddemtgyvatr
    wyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgael
    lkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalaha
    yfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppl