PDB entry 4ewh

View 4ewh on RCSB PDB site
Description: Co-crystal structure of ACK1 with inhibitor
Class: transferase/transferase inhibitor
Keywords: Drug Design, Enzyme Inhibitors, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-04-27, released 2012-09-19
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-10-31, with a file datestamp of 2012-10-26.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.259
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Activated CDC42 kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TNK2, ACK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d4ewha_
  • Chain 'B':
    Compound: Activated CDC42 kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TNK2, ACK1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: T77, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ewhA (A:)
    ltcligekdlrlleklgdgsfgvvrrgewdapsgktvsvavkclkpdvlsqpeamddfir
    evnamhsldhrnlirlygvvltppmkmvtelaplgslldrlrkhqghfllgtlsryavqv
    aegmgyleskrfihrdlaarnlllatrdlvkigdfglmralpqnddhyvmqehrkvpfaw
    capeslktrtfshasdtwmfgvtlwemftygqepwiglngsqilhkidkegerlprpedc
    pqdiynvmvqcwahkpedrptfvalrdflleaqpt
    

  • Chain 'B':
    No sequence available.