PDB entry 4evo

View 4evo on RCSB PDB site
Description: Crystal structure of Staphylococcal nuclease variant NVIAGA/E122G at cryogenic temperature
Class: hydrolase
Keywords: Staphylococcal nuclease, hyperstable variant, HYDROLASE
Deposited on 2012-04-26, released 2012-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-23, with a file datestamp of 2012-05-18.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.189
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered mutation (20)
      • engineered mutation (32)
      • engineered mutation (40)
      • engineered mutation (58)
      • engineered mutation (116)
      • engineered mutation (121)
      • engineered mutation (127)
    Domains in SCOPe 2.07: d4evoa_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4evoA (A:)
    atstkklhkepatlikaidgntvklmykgqpmvfrlllvdipetkhpkkgvekygpeaaa
    ftkkmvenakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnnt
    hgqhlrkaeaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4evoA (A:)
    lhkepatlikaidgntvklmykgqpmvfrlllvdipygpeaaaftkkmvenakkievefd
    kgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnnthgqhlrkaeaqakkekl
    niws