PDB entry 4evm

View 4evm on RCSB PDB site
Description: 1.5 Angstrom crystal structure of soluble domain of membrane-anchored thioredoxin family protein from Streptococcus pneumoniae strain Canada MDR_19A
Class: oxidoreductase
Keywords: Structural Genomics, NIAID, National Institute of Allergy and Infectious Diseases, Center for Structural Genomics of Infectious Diseases, CSGID, alpha/beta protein, thioredoxin fold, thioredoxin-like superfamily, TlpA-like family, Glutathione peroxidase-like family, OXIDOREDUCTASE
Deposited on 2012-04-26, released 2012-05-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-05-09, with a file datestamp of 2012-05-04.
Experiment type: XRAY
Resolution: 1.51 Å
R-factor: 0.17
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thioredoxin family protein
    Species: Streptococcus pneumoniae [TaxId:1313]
    Gene: SpneCM_010100000757, SP_0659
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4evma_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4evmA (A:)
evadfelmgvdgktyrlsdykgkkvylkfwaswcsiclaslpdtdeiakeagddyvvltv
vspghkgeqseadfknwykgldyknlpvlvdpsgklletygvrsyptqafidkegklvkt
hpgfmekdailqtlkela