PDB entry 4evi

View 4evi on RCSB PDB site
Description: Crystal Structure Analysis of Coniferyl Alcohol 9-O-Methyltransferase from Linum Nodiflorum in Complex with Coniferyl Alcohol 9-Methyl Ether and S -Adenosyl-L-Homocysteine
Class: transferase
Keywords: Rossmann fold, Dimer, small molecule O-methyltransferase, TRANSFERASE, S-Adenosyl-L-methionine, coniferyl alcohol,S -Adenosyl-L-homocysteine
Deposited on 2012-04-26, released 2013-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-05-15, with a file datestamp of 2013-05-10.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: 0.177
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Coniferyl alcohol 9-O-methyltransferase
    Species: Linum nodiflorum [TaxId:407264]
    Gene: CA9OMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4evia1, d4evia2
  • Chain 'B':
    Compound: Coniferyl alcohol 9-O-methyltransferase
    Species: Linum nodiflorum [TaxId:407264]
    Gene: CA9OMT
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6XNE6 (20-387)
      • expression tag (12-14)
    Domains in SCOPe 2.07: d4evib1, d4evib2, d4evib3
  • Heterogens: SAH, C9M, GOL, N7I, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4eviA (A:)
    mgsshhhhhhssglvprgshmdaatavelldaqpqvwhhflgyinsmtlqcaleldiadv
    ihrhghpiplnqlaaaleipqtkapflsrlmrmlvhlgyftqvitkpedenddvlpsywl
    aplsrlllkqnpynarsltfcsvhehlvdpwrqmsawlrtgkedgkdtpnafafahegkk
    vyevcsedanfsqlfsegmagdswlfsralvskcrdafeglsslvdvgggtgntskviae
    tfpnihctvfdlphvvsgpkqthpnldyesgnmftdeiphadavlfkwvlcdwpdepvlk
    mlkqckkaltkngvkgklmiadhvldhescndsnsmgtslildmlfmsflegslrtekqw
    aklfaeagfkdykitpvgglrvlievyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eviA (A:)
    mdaatavelldaqpqvwhhflgyinsmtlqcaleldiadvihrhghpiplnqlaaaleip
    qtkapflsrlmrmlvhlgyftqvitklpsywlaplsrlllkqnpynarsltfcsvhehlv
    dpwrqmsawlrtgkedgkdtpnafafahegkkvyevcsedanfsqlfsegmagdswlfsr
    alvskcrdafeglsslvdvgggtgntskviaetfpnihctvfdlphvvsgpkqthpnldy
    esgnmftdeiphadavlfkwvlcdwpdepvlkmlkqckkaltkngvkgklmiadhvldhe
    scndsnsmgtslildmlfmsflegslrtekqwaklfaeagfkdykitpvgglrvlievyp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4eviB (B:)
    mgsshhhhhhssglvprgshmdaatavelldaqpqvwhhflgyinsmtlqcaleldiadv
    ihrhghpiplnqlaaaleipqtkapflsrlmrmlvhlgyftqvitkpedenddvlpsywl
    aplsrlllkqnpynarsltfcsvhehlvdpwrqmsawlrtgkedgkdtpnafafahegkk
    vyevcsedanfsqlfsegmagdswlfsralvskcrdafeglsslvdvgggtgntskviae
    tfpnihctvfdlphvvsgpkqthpnldyesgnmftdeiphadavlfkwvlcdwpdepvlk
    mlkqckkaltkngvkgklmiadhvldhescndsnsmgtslildmlfmsflegslrtekqw
    aklfaeagfkdykitpvgglrvlievyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eviB (B:)
    glvmdaatavelldaqpqvwhhflgyinsmtlqcaleldiadvihrhghpiplnqlaaal
    eipqtkapflsrlmrmlvhlgyftqvitkplpsywlaplsrlllkqnpynarsltfcsvh
    ehlvdpwrqmsawlrtgkgkdtpnafafahegkkvyevcsedanfsqlfsegmagdswlf
    sralvskcrdafeglsslvdvgggtgntskviaetfpnihctvfdlgpkqthpnldyesg
    nmftdeiphadavlfkwvlcdwpdepvlkmlkqckkaltvkgklmiadhvldhescndsn
    smgtslildmlfmsflegslrtekqwaklfaeagfkdykitpvgglrvlievyp