PDB entry 4evd

View 4evd on RCSB PDB site
Description: Crystal Structure HP-NAP from strain YS29 cadmium loaded (Cocrystallization 50mM)
Class: metal transport
Keywords: dodecamer, four-helix bundle, metal transport
Deposited on 2012-04-26, released 2012-06-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-06-27, with a file datestamp of 2012-06-22.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.215
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neutrophil-activating protein
    Species: Helicobacter pylori [TaxId:210]
    Gene: NAPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4evda_
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4evdA (A:)
    mgsshhhhhhssglvprgshmktfeilkhlqadaivlfmkvhnfhwnvkgtdffnvhkat
    eeiyeefadmfddlaerivqlghhplvtlseaikltrvkeetktsfhskdifkeiledyk
    hlekefkelsntaekegdkvtvtyaddqlaklqksiwmlqahla
    

    Sequence, based on observed residues (ATOM records): (download)
    >4evdA (A:)
    ktfeilkhlqadaivlfmkvhnfhwnvkgtdffnvhkateeiyeefadmfddlaerivql
    ghhplvtlseaikltrvkeetktsfhskdifkeiledykhlekefkelsntaekegdkvt
    vtyaddqlaklqksiwmlqahla