PDB entry 4ev8

View 4ev8 on RCSB PDB site
Description: Crystal structure of mouse catenin beta-59 in 2.4M urea.
Class: cell adhesion
Keywords: mouse catenin, CELL ADHESION
Deposited on 2012-04-26, released 2013-05-01
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-05-01, with a file datestamp of 2013-04-26.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.179
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catenin beta-1
    Species: Mus musculus [TaxId:10090]
    Gene: Ctnnb1, Catnb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4ev8a_
  • Heterogens: URE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ev8A (A:)
    havvnlinyqddaelatraipeltkllndedqvvvnkaavmvhqlskkeasrhaimrspq
    mvsaivrtmqntndvetarctagtlhnlshhregllaifksggipalvkmlgspvdsvlf
    yaittlhnlllhqegakmavrlagglqkmvallnktnvkflaittdclqilaygnqeskl
    iilasggpqalvnimrtytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltdp
    sqrlvqnclwtlrnlsdaatkqegmegllgtlvqllgsddinvvtcaagilsnltcnnyk
    nkmmvcqvggiealvrtvlragdreditepaicalrhltsrhqeaemaqnavrlhyglpv
    vvkllhppshwplikatvglirnlalcpanhaplreqgaiprlvqllvrahqdtqrrtsm
    ggtqqqfvegvrmeeivegctgalhilardvhnrivirglntiplfvqllyspieniqrv
    aagvlcelaqdkeaaeaieaegatapltellhsrnegvatyaaavlfrmsedkpqdyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ev8A (A:)
    llndedqvvvnkaavmvhqlskkeasrhaimrspqmvsaivrtmqntndvetarctagtl
    hnlshhregllaifksggipalvkmlgspvdsvlfyaittlhnlllhqegakmavrlagg
    lqkmvallnktnvkflaittdclqilaygnqeskliilasggpqalvnimrtytyekllw
    ttsrvlkvlsvcssnkpaiveaggmqalglhltdpsqrlvqnclwtlrnlsdaatkqegm
    egllgtlvqllgsddinvvtcaagilsnltcnnyknkmmvcqvggiealvrtvlragdre
    ditepaicalrhltsrhqeaemaqnavrlhyglpvvvkllhppshwplikatvglirnla
    lcpanhaplreqgaiprlvqllvrahqdtqregvrmeeivegctgalhilardvhnrivi
    rglntiplfvqllyspieniqrvaagvlcelaqdkeaaeaieaegatapltellhsrneg
    vatyaaavlfrm