PDB entry 4euk

View 4euk on RCSB PDB site
Description: Crystal structure
Class: signaling protein
Keywords: multistep phosphorelay, two-component system, plant signalling, signal transduction, sensor histidine kinase, phosphotransfer protein, response regulator, TRANSFERASE, SIGNALING PROTEIN
Deposited on 2012-04-25, released 2013-02-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-06-05, with a file datestamp of 2013-05-31.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.173
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histidine kinase 5
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AHK5, At5g10720, CKI2, MAJ23.80
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Histidine-containing phosphotransfer protein 1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AHP1, At3g21510, ATHP3, MIL23.8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4eukb_
  • Heterogens: MG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4eukB (B:)
    gplgsmdlvqkqkslqdytkslflegildsqflqlqqlqdesnpdfvsqvvtlffqdsdr
    ilndlslsldqqvvdfkkvdphvhqlkgssssigaqrvknacvvfrsfceqqnveachrc
    lqqvkqeyylvknrletlfkleqqivasggmipavelgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eukB (B:)
    mdlvqkqkslqdytkslflegildsqflqlqqlqdesnpdfvsqvvtlffqdsdrilndl
    slsldqqvvdfkkvdphvhqlkgssssigaqrvknacvvfrsfceqqnveachrclqqvk
    qeyylvknrletlfkleqqivasggmipavel