PDB entry 4eui

View 4eui on RCSB PDB site
Description: Crystal Structure of MIF L46F mutant
Class: isomerase
Keywords: Keto-enol tautomerase, ISOMERASE
Deposited on 2012-04-25, released 2012-10-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-07-24, with a file datestamp of 2013-07-19.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.225
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: MIF, GLIF, MMIF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14174 (0-113)
      • engineered mutation (45)
    Domains in SCOPe 2.08: d4euia_
  • Chain 'B':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: MIF, GLIF, MMIF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14174 (0-113)
      • engineered mutation (45)
    Domains in SCOPe 2.08: d4euib_
  • Chain 'C':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: MIF, GLIF, MMIF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14174 (0-113)
      • engineered mutation (45)
    Domains in SCOPe 2.08: d4euic_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4euiA (A:)
pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqfmafggssepcalcs
lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4euiB (B:)
pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqfmafggssepcalcs
lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4euiC (C:)
pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqfmafggssepcalcs
lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa