PDB entry 4eug

View 4eug on RCSB PDB site
Description: Crystallographic and Enzymatic Studies of an Active Site Variant H187Q of Escherichia Coli Uracil DNA Glycosylase: Crystal Structures of Mutant H187Q and its Uracil Complex
Class: hydrolase
Keywords: glycosylase, hydrolase
Deposited on 1998-12-27, released 1999-07-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.179
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (glycosylase)
    Species: Escherichia coli [TaxId:37762]
    Gene: UNG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12295 (Start-228)
      • engineered (186)
      • mutation (212)
    Domains in SCOPe 2.04: d4euga_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4eugA (A:)
    maneltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvi
    lgqdpyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvl
    llntvltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrh
    hvlkapqpsplsahrgffgcnhfvlanqwleqhgetpidwmpvlpaese
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eugA (A:)
    ltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilgqd
    pyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvlllnt
    vltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhvlk
    apqpsplsahrgffgcnhfvlanqwleqhgetpidwmpvlpaese