PDB entry 4eu1

View 4eu1 on RCSB PDB site
Description: Structure of a mitochondrial aspartate aminotransferase from Trypanosoma brucei
Class: transferase
Keywords: SSGCID, Aspartate aminotransferase, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, pyridoxalphosphate lysine, mitochondrial, TRANSFERASE
Deposited on 2012-04-25, released 2012-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-05-20, with a file datestamp of 2015-05-15.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitochondrial aspartate aminotransferase
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: Tb11.02.2740
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q964F0 (Start-408)
      • conflict (271)
      • conflict (295)
    Domains in SCOPe 2.07: d4eu1a_
  • Chain 'B':
    Compound: Mitochondrial aspartate aminotransferase
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: Tb11.02.2740
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q964F0 (Start-408)
      • conflict (271)
      • conflict (295)
    Domains in SCOPe 2.07: d4eu1b_
  • Heterogens: EDO, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4eu1A (A:)
    mahhhhhhmgtleaqtqgpgsmgkpdpilglgqdfrmdpakrkvnlsigvyrddadqpfv
    lecvkqatlgtnmdyapvtgiasfveeaqklcfgptcaalrdgriascqtlggtgalrig
    gdllnrfvancnriygpdvgypnhesifakagmeltpysyydpatkglnlagmlecldka
    pegsvilvhacahnptgvdpthddwrqvcdvikrrnhipfvdmayqgfatgqldydafvp
    rhlvdmvpnlivaqsfsknfglyghrcgalhistasaeeakrlvsqlallirpmynnppl
    ygawvvssilkdpqltalwkkelkqmssriaevrkrlvselkacgsvhdwshierqvgmm
    aytgltreqvellrseyhiymtlngraavsglnstnveyvsqaihnvtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eu1A (A:)
    pilglgqdfrmdpakrkvnlsigvyrddadqpfvlecvkqatlgtnmdyapvtgiasfve
    eaqklcfgptcaalrdgriascqtlggtgalriggdllnrfvancnriygpdvgypnhes
    ifakagmeltpysyydpatkglnlagmlecldkapegsvilvhacahnptgvdpthddwr
    qvcdvikrrnhipfvdmayqgfatgqldydafvprhlvdmvpnlivaqsfsknfglyghr
    cgalhistasaeeakrlvsqlallirpmynnpplygawvvssilkdpqltalwkkelkqm
    ssriaevrkrlvselkacgsvhdwshierqvgmmaytgltreqvellrseyhiymtlngr
    aavsglnstnveyvsqaihnvtk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4eu1B (B:)
    mahhhhhhmgtleaqtqgpgsmgkpdpilglgqdfrmdpakrkvnlsigvyrddadqpfv
    lecvkqatlgtnmdyapvtgiasfveeaqklcfgptcaalrdgriascqtlggtgalrig
    gdllnrfvancnriygpdvgypnhesifakagmeltpysyydpatkglnlagmlecldka
    pegsvilvhacahnptgvdpthddwrqvcdvikrrnhipfvdmayqgfatgqldydafvp
    rhlvdmvpnlivaqsfsknfglyghrcgalhistasaeeakrlvsqlallirpmynnppl
    ygawvvssilkdpqltalwkkelkqmssriaevrkrlvselkacgsvhdwshierqvgmm
    aytgltreqvellrseyhiymtlngraavsglnstnveyvsqaihnvtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eu1B (B:)
    lglgqdfrmdpakrkvnlsigvyrddadqpfvlecvkqatlgtnmdyapvtgiasfveea
    qklcfgptcaalrdgriascqtlggtgalriggdllnrfvancnriygpdvgypnhesif
    akagmeltpysyydpatkglnlagmlecldkapegsvilvhacahnptgvdpthddwrqv
    cdvikrrnhipfvdmayqgfatgqldydafvprhlvdmvpnlivaqsfsknfglyghrcg
    alhistasaeeakrlvsqlallirpmynnpplygawvvssilkdpqltalwkkelkqmss
    riaevrkrlvselkacgsvhdwshierqvgmmaytgltreqvellrseyhiymtlngraa
    vsglnstnveyvsqaihnvtk