PDB entry 4etw

View 4etw on RCSB PDB site
Description: Structure of the Enzyme-ACP Substrate Gatekeeper Complex Required for Biotin Synthesis
Class: Hydrolase
Keywords: esterase, Hydrolase
Deposited on 2012-04-24, released 2012-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-11-07, with a file datestamp of 2012-11-02.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.194
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pimelyl-[acyl-carrier protein] methyl ester esterase
    Species: Shigella flexneri [TaxId:623]
    Gene: bioH, SF3435, S4329
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83PW0 (Start-256)
      • engineered mutation (81)
      • engineered mutation (242)
    Domains in SCOPe 2.07: d4etwa_
  • Chain 'B':
    Compound: Acyl carrier protein
    Species: Shigella flexneri 5 [TaxId:373384]
    Gene: acpP, SFV_1114, SSON_1114
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4etwb_
  • Chain 'C':
    Compound: Pimelyl-[acyl-carrier protein] methyl ester esterase
    Species: Shigella flexneri [TaxId:623]
    Gene: bioH, SF3435, S4329
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83PW0 (Start-256)
      • engineered mutation (81)
      • engineered mutation (242)
    Domains in SCOPe 2.07: d4etwc_
  • Chain 'D':
    Compound: Acyl carrier protein
    Species: Shigella flexneri 5 [TaxId:373384]
    Gene: acpP, SFV_1114, SSON_1114
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4etwd_
  • Heterogens: ZMK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4etwA (A:)
    mnniwwqtkgqgnvhlvllhgwglnaevwrcideelsshftlhlvdlpgfgrsrgfgals
    ladmaeavlqqapdkaiwlgwalgglvasqialthpervqalvtvasspcfsardewpgi
    kpdvlagfqqqlsddfqrtverflalqtmgtetarqdaralkktvlalpmpevdvlnggl
    eilktvdlrqplqnvsmpflrlygyldglvprkvvpmldklwphsesyifakaahapfis
    hpaefchllvalkqrvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4etwA (A:)
    niwwqtkgqgnvhlvllhgwglnaevwrcideelsshftlhlvdlpgfgrsrgfgalsla
    dmaeavlqqapdkaiwlgwalgglvasqialthpervqalvtvasspcfsardewpgikp
    dvlagfqqqlsddfqrtverflalqtmgtetarqdaralkktvlalpmpevdvlngglei
    lktvdlrqplqnvsmpflrlygyldglvprkvvpmldklwphsesyifakaahapfishp
    aefchllvalkqrvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4etwB (B:)
    stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
    kittvqaaidyinghqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4etwB (B:)
    stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
    kittvqaaidyingh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4etwC (C:)
    mnniwwqtkgqgnvhlvllhgwglnaevwrcideelsshftlhlvdlpgfgrsrgfgals
    ladmaeavlqqapdkaiwlgwalgglvasqialthpervqalvtvasspcfsardewpgi
    kpdvlagfqqqlsddfqrtverflalqtmgtetarqdaralkktvlalpmpevdvlnggl
    eilktvdlrqplqnvsmpflrlygyldglvprkvvpmldklwphsesyifakaahapfis
    hpaefchllvalkqrvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4etwC (C:)
    niwwqtkgqgnvhlvllhgwglnaevwrcideelsshftlhlvdlpgfgrsrgfgalsla
    dmaeavlqqapdkaiwlgwalgglvasqialthpervqalvtvasspcfsardewpgikp
    dvlagfqqqlsddfqrtverflalqtmgtetarqdaralkktvlalpmpevdvlngglei
    lktvdlrqplqnvsmpflrlygyldglvprkvvpmldklwphsesyifakaahapfishp
    aefchllvalkqrvl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4etwD (D:)
    stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
    kittvqaaidyinghqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4etwD (D:)
    stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
    kittvqaaidyingh