PDB entry 4etg

View 4etg on RCSB PDB site
Description: Crystal Structure of MIF L46G mutant
Class: Isomerase
Keywords: Keto-enol tautomerase, Isomerase
Deposited on 2012-04-24, released 2012-10-03
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-08-07, with a file datestamp of 2013-08-02.
Experiment type: XRAY
Resolution: 1.61 Å
R-factor: 0.221
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: MIF, GLIF, MMIF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14174 (0-113)
      • engineered mutation (45)
    Domains in SCOPe 2.03: d4etga_
  • Chain 'B':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: MIF, GLIF, MMIF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14174 (0-113)
      • engineered mutation (45)
    Domains in SCOPe 2.03: d4etgb_
  • Chain 'C':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: MIF, GLIF, MMIF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14174 (0-113)
      • engineered mutation (45)
    Domains in SCOPe 2.03: d4etgc_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4etgA (A:)
pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqgmafggssepcalcs
lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4etgB (B:)
pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqgmafggssepcalcs
lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4etgC (C:)
pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqgmafggssepcalcs
lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa