PDB entry 4et7

View 4et7 on RCSB PDB site
Description: Crystal structure of Eph receptor 5
Class: transferase
Keywords: eph receptor, ATP-binding, Glycoprotein, Nucleotide-binding, Phosphoprotein, Transferase, Transmembrane, Tyrosine-protein kinase
Deposited on 2012-04-24, released 2013-05-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-05-22, with a file datestamp of 2013-05-17.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.212
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ephrin type-A receptor 5
    Species: Homo sapiens [TaxId:9606]
    Gene: BSK, EHK1, EPHA5, HEK7, TYRO4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54756 (2-End)
      • see remark 999 (175)
    Domains in SCOPe 2.04: d4et7a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4et7A (A:)
    gsnevnlldsrtvmgdlgwiafpkngweeigevdenyapihtyqvckvmeqnqnnwllts
    wisnegasrifielkftlrdcnslpgglgtcketfnmyyfesddqngrnikenqyikidt
    iaadesfteldlgdrvmklntevrdvgplskkgfylafqdvgacialvsvrvyykeaps
    

    Sequence, based on observed residues (ATOM records): (download)
    >4et7A (A:)
    nevnlldsrtvmgdlgwiafpkngweeigevdenyapihtyqvckvmeqnqnnwlltswi
    snegasrifielkftlrdcnslpgglgtcketfnmyyfesddqngrnikenqyikidtia
    adesfteldlgdrvmklntevrdvgplskkgfylafqdvgacialvsvrvyyke