PDB entry 4esr

View 4esr on RCSB PDB site
Description: Molecular and Structural Characterization of the SH3 Domain of AHI-1 in Regulation of Cellular Resistance of BCR-ABL+ Chronic Myeloid Leukemia Cells to Tyrosine Kinase Inhibitors
Class: protein binding
Keywords: AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, Dynamin-2, Protein binding, Chronic myeloid leukemia
Deposited on 2012-04-23, released 2012-06-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-11-14, with a file datestamp of 2012-11-09.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: 0.125
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Jouberin
    Species: Homo sapiens [TaxId:9606]
    Gene: AHI1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4esra_
  • Chain 'B':
    Compound: Jouberin
    Species: Homo sapiens [TaxId:9606]
    Gene: AHI1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4esrb_
  • Heterogens: PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4esrA (A:)
    hqvdtaptvvalydytanrsdeltihrgdiirvffkdnedwwygsigkgqegyfpanhva
    setlyqelp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4esrA (A:)
    taptvvalydytanrsdeltihrgdiirvffkdnedwwygsigkgqegyfpanhvasetl
    yqelp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4esrB (B:)
    hqvdtaptvvalydytanrsdeltihrgdiirvffkdnedwwygsigkgqegyfpanhva
    setlyqelp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4esrB (B:)
    aptvvalydytanrsdeltihrgdiirvffkdnedwwygsigkgqegyfpanhvasetly
    qelp