PDB entry 4ese

View 4ese on RCSB PDB site
Description: The crystal structure of azoreductase from Yersinia pestis CO92 in complex with FMN.
Class: oxidoreductase
Keywords: azoreductase, structural genomics, The Center for Structural Genomics of Infectious Diseases, CSGID, NIAID, National Institute of Allergy and Infectious Diseases, OXIDOREDUCTASE
Deposited on 2012-04-23, released 2012-05-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-05-23, with a file datestamp of 2012-05-18.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.175
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FMN-dependent NADH-azoreductase
    Species: Yersinia pestis [TaxId:214092]
    Gene: azoR, y2010, YPO2323, YP_2110
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZE60 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.08: d4esea1, d4esea2
  • Heterogens: FMN, 12P, GOL, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4eseA (A:)
    snamskvlvlkssilatssqsnqladffveqwqaahagdqitvrdlaaqpipvldgelvg
    alrpsgtaltprqqealalsdeliaelqandviviaapmynfniptqlknyfdmiaragv
    tfrytekgpeglvtgkraiiltsrggihkdtptdlvvpylrlflgfigitdvefvfaegi
    aygpevatkaqadaktllaqvvaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eseA (A:)
    amskvlvlkssilatssqsnqladffveqwqaahagdqitvrdlaaqpipvldgelvgal
    rpsgtaltprqqealalsdeliaelqandviviaapmynfniptqlknyfdmiaragvtf
    rytekgpeglvtgkraiiltsrgdlvvpylrlflgfigitdvefvfaegiaygpevatka
    qadaktllaqvva