PDB entry 4es4

View 4es4 on RCSB PDB site
Description: Crystal structure of YdiV and FlhD complex
Class: transcription
Keywords: Flagellar regulation, TRANSCRIPTION
Deposited on 2012-04-22, released 2012-10-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-07-03, with a file datestamp of 2013-06-28.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.247
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative cyclic di-GMP regulator CdgR
    Species: Escherichia coli [TaxId:83333]
    Gene: cdgR, ydiV, b1707, JW1697
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Flagellar transcriptional regulator FlhD
    Species: Escherichia coli [TaxId:83333]
    Gene: flhD, flbB, b1892, JW1881
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4es4b_
  • Chain 'C':
    Compound: Putative cyclic di-GMP regulator CdgR
    Species: Escherichia coli [TaxId:83333]
    Gene: cdgR, ydiV, b1707, JW1697
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Flagellar transcriptional regulator FlhD
    Species: Escherichia coli [TaxId:83333]
    Gene: flhD, flbB, b1892, JW1881
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4es4d_
  • Chain 'E':
    Compound: Putative cyclic di-GMP regulator CdgR
    Species: Escherichia coli [TaxId:83333]
    Gene: cdgR, ydiV, b1707, JW1697
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Flagellar transcriptional regulator FlhD
    Species: Escherichia coli [TaxId:83333]
    Gene: flhD, flbB, b1892, JW1881
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4es4f_
  • Chain 'G':
    Compound: Putative cyclic di-GMP regulator CdgR
    Species: Escherichia coli [TaxId:83333]
    Gene: cdgR, ydiV, b1707, JW1697
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Flagellar transcriptional regulator FlhD
    Species: Escherichia coli [TaxId:83333]
    Gene: flhD, flbB, b1892, JW1881
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4es4h_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4es4B (B:)
    mhtsellkhiydinlsylllaqrlivqdkasamfrlgineemattlaaltlpqmvklaet
    nqlvchfrfdshqtitqltqdsrvddlqqihtgimlstrllndvnqpeealrkkra
    

    Sequence, based on observed residues (ATOM records): (download)
    >4es4B (B:)
    htsellkhiydinlsylllaqrlivqdkasamfrlgineemattlaaltlpqmvklaetn
    qlvchfrfdshqtitqltqd
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4es4D (D:)
    mhtsellkhiydinlsylllaqrlivqdkasamfrlgineemattlaaltlpqmvklaet
    nqlvchfrfdshqtitqltqdsrvddlqqihtgimlstrllndvnqpeealrkkra
    

    Sequence, based on observed residues (ATOM records): (download)
    >4es4D (D:)
    mhtsellkhiydinlsylllaqrlivqdkasamfrlgineemattlaaltlpqmvklaet
    nqlvchfrfdshqtitqltqd
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4es4F (F:)
    mhtsellkhiydinlsylllaqrlivqdkasamfrlgineemattlaaltlpqmvklaet
    nqlvchfrfdshqtitqltqdsrvddlqqihtgimlstrllndvnqpeealrkkra
    

    Sequence, based on observed residues (ATOM records): (download)
    >4es4F (F:)
    htsellkhiydinlsylllaqrlivqdkasamfrlgineemattlaaltlpqmvklaetn
    qlvchfrfdshqtitqltqd
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4es4H (H:)
    mhtsellkhiydinlsylllaqrlivqdkasamfrlgineemattlaaltlpqmvklaet
    nqlvchfrfdshqtitqltqdsrvddlqqihtgimlstrllndvnqpeealrkkra
    

    Sequence, based on observed residues (ATOM records): (download)
    >4es4H (H:)
    mhtsellkhiydinlsylllaqrlivqdkasamfrlgineemattlaaltlpqmvklaet
    nqlvchfrfdshqtitqltqd