PDB entry 4ero

View 4ero on RCSB PDB site
Description: Study on structure and function relationships in human Pirin with Cobalt ion
Class: oxidoreductase
Keywords: beta sandwich, cupin, metatl binding protein, transcription activity, protein binding, nucleus, OXIDOREDUCTASE
Deposited on 2012-04-20, released 2013-05-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-09-04, with a file datestamp of 2013-08-30.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.195
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pirin
    Species: Homo sapiens [TaxId:9606]
    Gene: human, PIR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4eroa_
  • Heterogens: CO, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4eroA (A:)
    mgsskkvtlsvlsreqsegvgarvrrsigrpelknldpfllfdefkggrpggfpdhphrg
    fetvsylleggsmahedfcghtgkmnpgdlqwmtagrgilhaempcseepahglqlwvnl
    rssekmvepqyqelkseeipkpskdgvtvavisgealgikskvytrtptlyldfkldpga
    khsqpipkgwtsfiytisgdvyigpddaqqkiephhtavlgegdsvqvenkdpkrshfvl
    iageplrepviqhgpfvmntneeisqaildfrnakngferaktwkskign
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eroA (A:)
    sskkvtlsvlsreqsegvgarvrrsigrpelknldpfllfdefkggrpggfpdhphrgfe
    tvsylleggsmahedfcghtgkmnpgdlqwmtagrgilhaempcseepahglqlwvnlrs
    sekmvepqyqelkseeipkpskdgvtvavisgealgikskvytrtptlyldfkldpgakh
    sqpipkgwtsfiytisgdvyigpddaqqkiephhtavlgegdsvqvenkdpkrshfvlia
    geplrepviqhgpfvmntneeisqaildfrnakngferaktwkskign