PDB entry 4erk

View 4erk on RCSB PDB site
Description: the complex structure of the map kinase erk2/olomoucine
Class: transferase
Keywords: transferase, serine/threonine-protein kinase, map kinase, erk2
Deposited on 1998-07-09, released 1999-07-22
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.214
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: extracellular regulated kinase 2
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d4erka_
  • Heterogens: SO4, OLO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4erkA (A:)
    hhhhhhmaaaaaagpemvrgqvfdvgprytnlsyigegaygmvcsaydnlnkvrvaikki
    spfehqtycqrtlreikillrfrheniigindiiraptieqmkdvyivqdlmetdlykll
    ktqhlsndhicyflyqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadp
    dhdhtgflteyvatrwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldq
    lnhilgilgspsqedlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltf
    nphkrieveqalahpyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqp
    gyrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4erkA (A:)
    aagpemvrgqvfdvgprytnlsyigegaygmvcsaydnlnkvrvaikkispfehqtycqr
    tlreikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhic
    yflyqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgfltey
    vatrwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgsp
    sqedlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqa
    lahpyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqpg