PDB entry 4eri

View 4eri on RCSB PDB site
Description: Evidence for a Dual Role of an Active Site Histidine in alpha-Amino-beta-Carboxymuconate-epsilon-Semialdehyde Decarboxylase
Class: lyase
Keywords: TIM Barrel, Decarboxylase, metal-binding, Zn, LYASE
Deposited on 2012-04-20, released 2012-08-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-08-22, with a file datestamp of 2012-08-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.207
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: nbaD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83V25
      • engineered mutation (227)
    Domains in SCOPe 2.05: d4eria_
  • Chain 'B':
    Compound: 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: nbaD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83V25
      • engineered mutation (227)
    Domains in SCOPe 2.05: d4erib_
  • Heterogens: ZN, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4eriA (A:)
    mkkpridmhshffpriseqeaakfdanhapwlqvsakgdtgsimmgknnfrpvyqalwdp
    afrieemdaqgvdvqvtcatpvmfgytweankaaqwaermndfalefaahnpqrikvlaq
    vplqdldlackeasravaaghlgiqignhlgdkdlddatleaflthcanedipilvhpwd
    mmggqrmkkwmlpwlvampaetqlailslilsgaferipkslkicfgygggsfafllgrv
    dnawrhrdivredcprppseyvdrffvdsavfnpgalellvsvmgedrvmlgsdypfplg
    eqkigglvlssnlgesakdkiisgnaskffninv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eriA (A:)
    kpridmhshffpriseqeaakfdanhapwlqvsakgdtgsimmgknnfrpvyqalwdpaf
    rieemdaqgvdvqvtcatpvmfgytweankaaqwaermndfalefaahnpqrikvlaqvp
    lqdldlackeasravaaghlgiqignhlgdkdlddatleaflthcanedipilvhpwdmm
    ggqrmkkwmlpwlvampaetqlailslilsgaferipkslkicfgygggsfafllgrvdn
    awrhrdivredcprppseyvdrffvdsavfnpgalellvsvmgedrvmlgsdypfplgeq
    kigglvlssnlgesakdkiisgnaskffnin
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4eriB (B:)
    mkkpridmhshffpriseqeaakfdanhapwlqvsakgdtgsimmgknnfrpvyqalwdp
    afrieemdaqgvdvqvtcatpvmfgytweankaaqwaermndfalefaahnpqrikvlaq
    vplqdldlackeasravaaghlgiqignhlgdkdlddatleaflthcanedipilvhpwd
    mmggqrmkkwmlpwlvampaetqlailslilsgaferipkslkicfgygggsfafllgrv
    dnawrhrdivredcprppseyvdrffvdsavfnpgalellvsvmgedrvmlgsdypfplg
    eqkigglvlssnlgesakdkiisgnaskffninv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eriB (B:)
    pridmhshffpriseqeaakfdanhapwlqvsakgdtgsimmgknnfrpvyqalwdpafr
    ieemdaqgvdvqvtcatpvmfgytweankaaqwaermndfalefaahnpqrikvlaqvpl
    qdldlackeasravaaghlgiqignhlgdkdlddatleaflthcanedipilvhpwdmmg
    gqrmkkwmlpwlvampaetqlailslilsgaferipkslkicfgygggsfafllgrvdna
    wrhrdivredcprppseyvdrffvdsavfnpgalellvsvmgedrvmlgsdypfplgeqk
    igglvlssnlgesakdkiisgnaskffnin