PDB entry 4erg

View 4erg on RCSB PDB site
Description: Evidence for a Dual Role of an Active Site Histidine in alpha-Amino-beta-Carboxymuconate-epsilon-Semialdehyde Decarboxylase
Class: lyase
Keywords: tim-barrel, decarboxylase, metal-binding, Fe, LYASE
Deposited on 2012-04-20, released 2012-08-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-08-22, with a file datestamp of 2012-08-17.
Experiment type: XRAY
Resolution: 2.79 Å
R-factor: 0.203
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: nbaD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83V25 (Start-333)
      • engineered mutation (227)
    Domains in SCOPe 2.04: d4erga_
  • Chain 'B':
    Compound: 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: nbaD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83V25 (Start-333)
      • engineered mutation (227)
    Domains in SCOPe 2.04: d4ergb_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ergA (A:)
    mkkpridmhshffpriseqeaakfdanhapwlqvsakgdtgsimmgknnfrpvyqalwdp
    afrieemdaqgvdvqvtcatpvmfgytweankaaqwaermndfalefaahnpqrikvlaq
    vplqdldlackeasravaaghlgiqignhlgdkdlddatleaflthcanedipilvhpwd
    mmggqrmkkwmlpwlvampaetqlailslilsgaferipkslkicfgygggsfafllgrv
    dnawrhrdivredcprppseyvdrffvdsavfnpgalellvsvmgedrvmlgsdypfplg
    eqkigglvlssnlgesakdkiisgnaskffninv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ergA (A:)
    kpridmhshffpriseqeaakfdanhapwlqvsakgdtgsimmgknnfrpvyqalwdpaf
    rieemdaqgvdvqvtcatpvmfgytweankaaqwaermndfalefaahnpqrikvlaqvp
    lqdldlackeasravaaghlgiqignhlgdkdlddatleaflthcanedipilvhpwdmm
    ggqrmkkwmlpwlvampaetqlailslilsgaferipkslkicfgygggsfafllgrvdn
    awrhrdivredcprppseyvdrffvdsavfnpgalellvsvmgedrvmlgsdypfplgeq
    kigglvlssnlgesakdkiisgnaskffninv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ergB (B:)
    mkkpridmhshffpriseqeaakfdanhapwlqvsakgdtgsimmgknnfrpvyqalwdp
    afrieemdaqgvdvqvtcatpvmfgytweankaaqwaermndfalefaahnpqrikvlaq
    vplqdldlackeasravaaghlgiqignhlgdkdlddatleaflthcanedipilvhpwd
    mmggqrmkkwmlpwlvampaetqlailslilsgaferipkslkicfgygggsfafllgrv
    dnawrhrdivredcprppseyvdrffvdsavfnpgalellvsvmgedrvmlgsdypfplg
    eqkigglvlssnlgesakdkiisgnaskffninv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ergB (B:)
    kpridmhshffpriseqeaakfdanhapwlqvsakgdtgsimmgknnfrpvyqalwdpaf
    rieemdaqgvdvqvtcatpvmfgytweankaaqwaermndfalefaahnpqrikvlaqvp
    lqdldlackeasravaaghlgiqignhlgdkdlddatleaflthcanedipilvhpwdmm
    ggqrmkkwmlpwlvampaetqlailslilsgaferipkslkicfgygggsfafllgrvdn
    awrhrdivredcprppseyvdrffvdsavfnpgalellvsvmgedrvmlgsdypfplgeq
    kigglvlssnlgesakdkiisgnaskffninv