PDB entry 4ere

View 4ere on RCSB PDB site
Description: crystal structure of MDM2 (17-111) in complex with compound 23
Class: Ligase/Ligase inhibitor
Keywords: MDM2, p53, protein-protein interaction, Ligase-Ligase inhibitor complex
Deposited on 2012-04-20, released 2012-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-02, with a file datestamp of 2012-12-28.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.25
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4erea_
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ereb_
  • Heterogens: 0R2, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ereA (A:)
    gsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhiv
    ycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ereA (A:)
    seqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlyhivycsndllgdlf
    gvpsfsvkehrkiytmiyrnlvvvn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ereB (B:)
    gsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhiv
    ycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ereB (B:)
    sqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlyhivycsndl
    lgdlfgvpsfsvkehrkiytmiyrnlvvvn