PDB entry 4er4

View 4er4 on RCSB PDB site
Description: high-resolution x-ray analyses of renin inhibitor-aspartic proteinase complexes
Class: hydrolase/hydrolase inhibitor
Keywords: hydrolase, acid proteinase, hydrolase-hydrolase inhibitor complex
Deposited on 1991-01-05, released 1991-04-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: endothiapepsin
    Species: Cryphonectria parasitica [TaxId:5116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4er4e_
  • Chain 'I':
    Compound: h-142
    Database cross-references and differences (RAF-indexed):
    • PDB 4ER4 (0-8)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4er4E (E:)
stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
ginifgdvalkaafvvfngattptlgfask

  • Chain 'I':
    No sequence available.