PDB entry 4eqy

View 4eqy on RCSB PDB site
Description: Crystal structure of Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase from Burkholderia thailandensis
Class: transferase
Keywords: SSGCID, beta helix, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, TRANSFERASE
Deposited on 2012-04-19, released 2012-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.161
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: 3848943, BTH_I2039, lpxA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4eqya_
  • Chain 'B':
    Compound: acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: 3848943, BTH_I2039, lpxA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4eqyb_
  • Chain 'C':
    Compound: acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: 3848943, BTH_I2039, lpxA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4eqyc_
  • Chain 'E':
    Compound: acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: 3848943, BTH_I2039, lpxA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4eqye_
  • Chain 'F':
    Compound: acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: 3848943, BTH_I2039, lpxA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4eqyf_
  • Chain 'G':
    Compound: acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: 3848943, BTH_I2039, lpxA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4eqyg_
  • Chain 'X':
    Compound: HIS-HIS-HIS peptide
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: 3848943, BTH_I2039, lpxA
    Database cross-references and differences (RAF-indexed):
    • PDB 4EQY (0-2)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4eqyA (A:)
    mahhhhhhmgtleaqtqgpgsmsrihptaiiepgaqlhetvevgpyaivgsnvtigartt
    igshsvieghttigednrighyasvggrpqdmkykdeptrlvigdrntirefttihtgtv
    qdagvttlgddnwimayvhighdcrvgshvvlssnaqmaghveigdwaivggmsgvhqyv
    rigahsmlggasalvqdippfviaagnkaephginveglrrrgfspdaisalrsayrily
    knslsleeakvqlselaqaggdgdaavkalvdfvessqrgiir
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eqyA (A:)
    srihptaiiepgaqlhetvevgpyaivgsnvtigarttigshsvieghttigednrighy
    asvggrpqdmkykdeptrlvigdrntirefttihtgtvqdagvttlgddnwimayvhigh
    dcrvgshvvlssnaqmaghveigdwaivggmsgvhqyvrigahsmlggasalvqdippfv
    iaagnkaephginveglrrrgfspdaisalrsayrilyknslsleeakvqlselaqaggd
    gdaavkalvdfvessqrgiir
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4eqyB (B:)
    mahhhhhhmgtleaqtqgpgsmsrihptaiiepgaqlhetvevgpyaivgsnvtigartt
    igshsvieghttigednrighyasvggrpqdmkykdeptrlvigdrntirefttihtgtv
    qdagvttlgddnwimayvhighdcrvgshvvlssnaqmaghveigdwaivggmsgvhqyv
    rigahsmlggasalvqdippfviaagnkaephginveglrrrgfspdaisalrsayrily
    knslsleeakvqlselaqaggdgdaavkalvdfvessqrgiir
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eqyB (B:)
    srihptaiiepgaqlhetvevgpyaivgsnvtigarttigshsvieghttigednrighy
    asvggrpqdmkykdeptrlvigdrntirefttihtgtvqdagvttlgddnwimayvhigh
    dcrvgshvvlssnaqmaghveigdwaivggmsgvhqyvrigahsmlggasalvqdippfv
    iaagnkaephginveglrrrgfspdaisalrsayrilyknslsleeakvqlselaqaggd
    gdaavkalvdfvessqrgiir
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4eqyC (C:)
    mahhhhhhmgtleaqtqgpgsmsrihptaiiepgaqlhetvevgpyaivgsnvtigartt
    igshsvieghttigednrighyasvggrpqdmkykdeptrlvigdrntirefttihtgtv
    qdagvttlgddnwimayvhighdcrvgshvvlssnaqmaghveigdwaivggmsgvhqyv
    rigahsmlggasalvqdippfviaagnkaephginveglrrrgfspdaisalrsayrily
    knslsleeakvqlselaqaggdgdaavkalvdfvessqrgiir
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eqyC (C:)
    rihptaiiepgaqlhetvevgpyaivgsnvtigarttigshsvieghttigednrighya
    svggrpqdmkykdeptrlvigdrntirefttihtgtvqdagvttlgddnwimayvhighd
    crvgshvvlssnaqmaghveigdwaivggmsgvhqyvrigahsmlggasalvqdippfvi
    aagnkaephginveglrrrgfspdaisalrsayrilyknslsleeakvqlselaqaggdg
    daavkalvdfvessqrgiir
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4eqyE (E:)
    mahhhhhhmgtleaqtqgpgsmsrihptaiiepgaqlhetvevgpyaivgsnvtigartt
    igshsvieghttigednrighyasvggrpqdmkykdeptrlvigdrntirefttihtgtv
    qdagvttlgddnwimayvhighdcrvgshvvlssnaqmaghveigdwaivggmsgvhqyv
    rigahsmlggasalvqdippfviaagnkaephginveglrrrgfspdaisalrsayrily
    knslsleeakvqlselaqaggdgdaavkalvdfvessqrgiir
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eqyE (E:)
    srihptaiiepgaqlhetvevgpyaivgsnvtigarttigshsvieghttigednrighy
    asvggrpqdmkykdeptrlvigdrntirefttihtgtvqdagvttlgddnwimayvhigh
    dcrvgshvvlssnaqmaghveigdwaivggmsgvhqyvrigahsmlggasalvqdippfv
    iaagnkaephginveglrrrgfspdaisalrsayrilyknslsleeakvqlselaqaggd
    gdaavkalvdfvessqrgiir
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4eqyF (F:)
    mahhhhhhmgtleaqtqgpgsmsrihptaiiepgaqlhetvevgpyaivgsnvtigartt
    igshsvieghttigednrighyasvggrpqdmkykdeptrlvigdrntirefttihtgtv
    qdagvttlgddnwimayvhighdcrvgshvvlssnaqmaghveigdwaivggmsgvhqyv
    rigahsmlggasalvqdippfviaagnkaephginveglrrrgfspdaisalrsayrily
    knslsleeakvqlselaqaggdgdaavkalvdfvessqrgiir
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eqyF (F:)
    rihptaiiepgaqlhetvevgpyaivgsnvtigarttigshsvieghttigednrighya
    svggrpqdmkykdeptrlvigdrntirefttihtgtvqdagvttlgddnwimayvhighd
    crvgshvvlssnaqmaghveigdwaivggmsgvhqyvrigahsmlggasalvqdippfvi
    aagnkaephginveglrrrgfspdaisalrsayrilyknslsleeakvqlselaqaggdg
    daavkalvdfvessqrgiir
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4eqyG (G:)
    mahhhhhhmgtleaqtqgpgsmsrihptaiiepgaqlhetvevgpyaivgsnvtigartt
    igshsvieghttigednrighyasvggrpqdmkykdeptrlvigdrntirefttihtgtv
    qdagvttlgddnwimayvhighdcrvgshvvlssnaqmaghveigdwaivggmsgvhqyv
    rigahsmlggasalvqdippfviaagnkaephginveglrrrgfspdaisalrsayrily
    knslsleeakvqlselaqaggdgdaavkalvdfvessqrgiir
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eqyG (G:)
    rihptaiiepgaqlhetvevgpyaivgsnvtigarttigshsvieghttigednrighya
    svggrpqdmkykdeptrlvigdrntirefttihtgtvqdagvttlgddnwimayvhighd
    crvgshvvlssnaqmaghveigdwaivggmsgvhqyvrigahsmlggasalvqdippfvi
    aagnkaephginveglrrrgfspdaisalrsayrilyknslsleeakvqlselaqaggdg
    daavkalvdfvessqrgiir
    

  • Chain 'X':
    No sequence available.