PDB entry 4equ

View 4equ on RCSB PDB site
Description: Human STK-10 (LOK) kinase domain in DFG-out conformation with inhibitor DSA-7
Class: transferase/transferase inhibitor
Keywords: serine/threonine kinase, TRANSFERASE, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-04-19, released 2012-11-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-12-19, with a file datestamp of 2012-12-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.224
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase 10
    Species: Homo sapiens [TaxId:9606]
    Gene: STK10, LOK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4equa_
  • Chain 'B':
    Compound: serine/threonine-protein kinase 10
    Species: Homo sapiens [TaxId:9606]
    Gene: STK10, LOK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4equb_
  • Heterogens: G6I, CA, 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4equA (A:)
    smrksreyehvrrdldpnevweivgelgdgafgkvykaknketgalaaakvietkseeel
    edyiveieilatcdhpyivkllgayyhdgklwimiefcpggavdaimleldrgltepqiq
    vvcrqmlealnflhskriihrdlkagnvlmtlegdirladfgvsaknlktlqkrdsfigt
    pywmapevvmcetmkdtpydykadiwslgitliemaqiepphhelnpmrvllkiaksdpp
    tlltpskwsvefrdflkialdknpetrpsaaqllehpfvssitsnkalrelvaeakaevm
    ee
    

    Sequence, based on observed residues (ATOM records): (download)
    >4equA (A:)
    ehvrrdldpnevweivgelgkvykaknketgalaaakvieledyiveieilatcdhpyiv
    kllgayyhdgklwimiefcpggavdaimleldrgltepqiqvvcrqmlealnflhskrii
    hrdlkagnvlmtlegdirladfgvsaknligtpywmapevvmcetmkdtpydykadiwsl
    gitliemaqiepphhelnpmrvllkiaksdpptlltpskwsvefrdflkialdknpetrp
    saaqllehpfvssitsnkalrelvaeakaevmee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4equB (B:)
    smrksreyehvrrdldpnevweivgelgdgafgkvykaknketgalaaakvietkseeel
    edyiveieilatcdhpyivkllgayyhdgklwimiefcpggavdaimleldrgltepqiq
    vvcrqmlealnflhskriihrdlkagnvlmtlegdirladfgvsaknlktlqkrdsfigt
    pywmapevvmcetmkdtpydykadiwslgitliemaqiepphhelnpmrvllkiaksdpp
    tlltpskwsvefrdflkialdknpetrpsaaqllehpfvssitsnkalrelvaeakaevm
    ee
    

    Sequence, based on observed residues (ATOM records): (download)
    >4equB (B:)
    ehvrrdldpnevweivgelgdgafgkvykaknketgalaaakvieeeledyiveieilat
    cdhpyivkllgayyhdgklwimiefcpggavdaimleldrgltepqiqvvcrqmlealnf
    lhskriihrdlkagnvlmtlegdirladfgvsaknlfigtpywmapevvmcetmkdtpyd
    ykadiwslgitliemaqiepphhelnpmrvllkiaksdpptlltpskwsvefrdflkial
    dknpetrpsaaqllehpfvssitsnkalrelvaeakaevmee