PDB entry 4eqn

View 4eqn on RCSB PDB site
Description: Crystal structure of Staphylococcal nuclease variant Delta+PHS V23E/I72K at cryogenic temperature
Class: hydrolase
Keywords: Staphylococcal nuclease, hyperstable, pdTp, ionizable group, HYDROLASE
Deposited on 2012-04-19, released 2012-05-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-03-06, with a file datestamp of 2013-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.177
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered mutation (22)
      • engineered mutation (43-44)
      • engineered mutation (65)
      • engineered mutation (110)
      • engineered mutation (117)
      • engineered mutation (121)
    Domains in SCOPe 2.06: d4eqna_
  • Heterogens: CA, THP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4eqnA (A:)
atstkklhkepatlikaidgdteklmykgqpmtfrlllvdtpefnekygpeasaftkkmv
enakkkevefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllr
kaeaqakkeklniwsednadsgq

    Sequence, based on observed residues (ATOM records): (download) 
    >4eqnA (A:)
klhkepatlikaidgdteklmykgqpmtfrlllvdtpefnekygpeasaftkkmvenakk
kevefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllrkaeaq
akkeklniws