PDB entry 4eqm

View 4eqm on RCSB PDB site
Description: Structural analysis of Staphylococcus aureus serine/threonine kinase PknB
Class: transferase
Keywords: Kinase, serine/threonine protein kinase, TRANSFERASE
Deposited on 2012-04-19, released 2012-06-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-06-27, with a file datestamp of 2012-06-22.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.216
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein kinase
    Species: Staphylococcus aureus subsp. aureus [TaxId:158879]
    Gene: SA1063
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4eqma_
  • Chain 'B':
    Compound: Protein kinase
    Species: Staphylococcus aureus subsp. aureus [TaxId:158879]
    Gene: SA1063
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4eqmb_
  • Chain 'C':
    Compound: Protein kinase
    Species: Staphylococcus aureus subsp. aureus [TaxId:158879]
    Gene: SA1063
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4eqmc_
  • Chain 'D':
    Compound: Protein kinase
    Species: Staphylococcus aureus subsp. aureus [TaxId:158879]
    Gene: SA1063
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4eqmd_
  • Chain 'E':
    Compound: Protein kinase
    Species: Staphylococcus aureus subsp. aureus [TaxId:158879]
    Gene: SA1063
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4eqme_
  • Chain 'F':
    Compound: Protein kinase
    Species: Staphylococcus aureus subsp. aureus [TaxId:158879]
    Gene: SA1063
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4eqmf_
  • Heterogens: ANP, BEN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4eqmA (A:)
    gshmigkiinerykivdklggggmstvylaedtilnikvaikaifipprekeetlkrfer
    evhnssqlshqnivsmidvdeeddcyylvmeyiegptlseyieshgplsvdtainftnqi
    ldgikhahdmrivhrdikpqnilidsnktlkifdfgiakalsetsltqtnhvlgtvqyfs
    peqakgeatdectdiysigivlyemlvgeppfngetavsiaikhiqdsvpnvttdvrkdi
    pqslsnvilratekdkanryktiqemkddlssvlhenranedvyeldkmktiav
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eqmA (A:)
    migkiinerykivdklggggmstvylaedtilnikvaikaifipprekeetlkrferevh
    nssqlshqnivsmidvdeeddcyylvmeyiegptlseyieshgplsvdtainftnqildg
    ikhahdmrivhrdikpqnilidsnktlkifdfgiakaltvqyfspeqakgeatdectdiy
    sigivlyemlvgeppfngetavsiaikhiqdsvpnvttdvrkdipqslsnvilratekdk
    anryktiqemkddlssvlhenranedvye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4eqmB (B:)
    gshmigkiinerykivdklggggmstvylaedtilnikvaikaifipprekeetlkrfer
    evhnssqlshqnivsmidvdeeddcyylvmeyiegptlseyieshgplsvdtainftnqi
    ldgikhahdmrivhrdikpqnilidsnktlkifdfgiakalsetsltqtnhvlgtvqyfs
    peqakgeatdectdiysigivlyemlvgeppfngetavsiaikhiqdsvpnvttdvrkdi
    pqslsnvilratekdkanryktiqemkddlssvlhenranedvyeldkmktiav
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eqmB (B:)
    migkiinerykivdklggggmstvylaedtilnikvaikaifipprekeetlkrferevh
    nssqlshqnivsmidvdeeddcyylvmeyiegptlseyieshgplsvdtainftnqildg
    ikhahdmrivhrdikpqnilidsnktlkifdfgiakaltvqyfspeqakgeatdectdiy
    sigivlyemlvgeppfngetavsiaikhiqdsvpnvttdvrkdipqslsnvilratekdk
    anryktiqemkddlssvlhenranedvye
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4eqmC (C:)
    gshmigkiinerykivdklggggmstvylaedtilnikvaikaifipprekeetlkrfer
    evhnssqlshqnivsmidvdeeddcyylvmeyiegptlseyieshgplsvdtainftnqi
    ldgikhahdmrivhrdikpqnilidsnktlkifdfgiakalsetsltqtnhvlgtvqyfs
    peqakgeatdectdiysigivlyemlvgeppfngetavsiaikhiqdsvpnvttdvrkdi
    pqslsnvilratekdkanryktiqemkddlssvlhenranedvyeldkmktiav
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eqmC (C:)
    migkiinerykivdklggggmstvylaedtilnikvaikaifipprekeetlkrferevh
    nssqlshqnivsmidvdeeddcyylvmeyiegptlseyieshgplsvdtainftnqildg
    ikhahdmrivhrdikpqnilidsnktlkifdfgiakaltvqyfspeqakgeatdectdiy
    sigivlyemlvgeppfngetavsiaikhiqdsvpnvttdvrkdipqslsnvilratekdk
    anryktiqemkddlssvlhenranedvye
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4eqmD (D:)
    gshmigkiinerykivdklggggmstvylaedtilnikvaikaifipprekeetlkrfer
    evhnssqlshqnivsmidvdeeddcyylvmeyiegptlseyieshgplsvdtainftnqi
    ldgikhahdmrivhrdikpqnilidsnktlkifdfgiakalsetsltqtnhvlgtvqyfs
    peqakgeatdectdiysigivlyemlvgeppfngetavsiaikhiqdsvpnvttdvrkdi
    pqslsnvilratekdkanryktiqemkddlssvlhenranedvyeldkmktiav
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eqmD (D:)
    migkiinerykivdklggggmstvylaedtilnikvaikaifipprekeetlkrferevh
    nssqlshqnivsmidvdeeddcyylvmeyiegptlseyieshgplsvdtainftnqildg
    ikhahdmrivhrdikpqnilidsnktlkifdfgiaktvqyfspeqakgeatdectdiysi
    givlyemlvgeppfngetavsiaikhiqdsvpnvttdvrkdipqslsnvilratekdkan
    ryktiqemkddlssvlhenranedvyel
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4eqmE (E:)
    gshmigkiinerykivdklggggmstvylaedtilnikvaikaifipprekeetlkrfer
    evhnssqlshqnivsmidvdeeddcyylvmeyiegptlseyieshgplsvdtainftnqi
    ldgikhahdmrivhrdikpqnilidsnktlkifdfgiakalsetsltqtnhvlgtvqyfs
    peqakgeatdectdiysigivlyemlvgeppfngetavsiaikhiqdsvpnvttdvrkdi
    pqslsnvilratekdkanryktiqemkddlssvlhenranedvyeldkmktiav
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eqmE (E:)
    migkiinerykivdklggggmstvylaedtilnikvaikaifipprekeetlkrferevh
    nssqlshqnivsmidvdeeddcyylvmeyiegptlseyieshgplsvdtainftnqildg
    ikhahdmrivhrdikpqnilidsnktlkifdfgiaktvqyfspeqakgeatdectdiysi
    givlyemlvgeppfngetavsiaikhiqdsvpnvttdvrkdipqslsnvilratekdkan
    ryktiqemkddlssvlhenranedvyel
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4eqmF (F:)
    gshmigkiinerykivdklggggmstvylaedtilnikvaikaifipprekeetlkrfer
    evhnssqlshqnivsmidvdeeddcyylvmeyiegptlseyieshgplsvdtainftnqi
    ldgikhahdmrivhrdikpqnilidsnktlkifdfgiakalsetsltqtnhvlgtvqyfs
    peqakgeatdectdiysigivlyemlvgeppfngetavsiaikhiqdsvpnvttdvrkdi
    pqslsnvilratekdkanryktiqemkddlssvlhenranedvyeldkmktiav
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eqmF (F:)
    migkiinerykivdklggggmstvylaedtilnikvaikaifipprekeetlkrferevh
    nssqlshqnivsmidvdeeddcyylvmeyiegptlseyieshgplsvdtainftnqildg
    ikhahdmrivhrdikpqnilidsnktlkifdfgiaktvqyfspeqakgeatdectdiysi
    givlyemlvgeppfngetavsiaikhiqdsvpnvttdvrkdipqslsnvilratekdkan
    ryktiqemkddlssvlhenranedvyel