PDB entry 4eph

View 4eph on RCSB PDB site
Description: CRYSTAL STRUCTURE OF RAT CARNITINE PALMITOYLTRANSFERASE 2 IN COMPLEX with CoA-site inhibitor
Class: transferase/transferase inhibitor
Keywords: TRANSFERASE, ACYLTRANSFERASE, MITOCHONDRIAL PROTEIN, CoA, acylcarnitine, mitochondrial inner membrane, lipid transport, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-04-17, released 2013-04-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carnitine O-palmitoyltransferase 2, mitochondrial
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Cpt2, Cpt-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4epha1
  • Heterogens: 0RK, BOG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ephA (A:)
    mgsshhhhhhssglvprgshmavsgpddylqhsivptmhyqdslprlpipkledtmkryl
    naqkpllddsqfrrtealcknfetgvgkelhahllaqdkqnkhtsyisgpwfdmyltard
    sivlnfnpfmafnpdpkseyndqltratnltvsavrflktlqagllepevfhlnpsksdt
    dafkrlirfvppslswygaylvnaypldmsqyfrlfnstriprpnrdelftdtkarhllv
    lrkghfyvfdvldqdgnivnpleiqahlkyilsdsspvpefpvayltsenrdvwaelrqk
    lifdgneetlkkvdsavfclclddfpmkdlihlshtmlhgdgtnrwfdksfnlivaedgt
    aavhfehswgdgvavlrffnevfrdstqtpaitpqsqpaatnssasvetlsfnlsgalka
    gitaakekfdttvktlsidsiqfqrggkeflkkkqlspdavaqlafqmaflrqygqtvat
    yescstaafkhgrtetirpasiftkrcseafvrdpskhsvgelqhmmaecskyhgqltke
    aamgqgfdrhlyalrylatarglnlpelyldpayqqmnhnilststlnspavslggfapv
    vpdgfgiayavhddwigcnvssysgrnareflhcvqkcledifdalegkaikt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ephA (A:)
    ddylqhsivptmhyqdslprlpipkledtmkrylnaqkpllddsqfrrtealcknfetgv
    gkelhahllaqdkqnkhtsyisgpwfdmyltardsivlnfnpfmafnpdpkseyndqltr
    atnltvsavrflktlqagllepevfhlnpsksdtdafkrlirfvppslswygaylvnayp
    ldmsqyfrlfnstriprpnrdelftdtkarhllvlrkghfyvfdvldqdgnivnpleiqa
    hlkyilsdsspvpefpvayltsenrdvwaelrqklifdgneetlkkvdsavfclclddfp
    mkdlihlshtmlhgdgtnrwfdksfnlivaedgtaavhfehswgdgvavlrffnevfrds
    tqtpaitpqsqpaatnssasvetlsfnlsgalkagitaakekfdttvktlsidsiqfqrg
    gkeflkkkqlspdavaqlafqmaflrqygqtvatyescstaafkhgrtetirpasiftkr
    cseafvrdpskhsvgelqhmmaecskyhgqltkeaamgqgfdrhlyalrylatarglnlp
    elyldpayqqmnhnilststlnspavslggfapvvpdgfgiayavhddwigcnvssysgr
    nareflhcvqkcledifdalegkai