PDB entry 4epd

View 4epd on RCSB PDB site
Description: Initial Urease Structure for Radiation Damage Experiment at 300 K
Class: hydrolase
Keywords: alpha-beta barrel, nickel metalloenzyme, hydrolase, radiation damage
Deposited on 2012-04-17, released 2012-08-29
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-08-29, with a file datestamp of 2012-08-24.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.145
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Urease subunit gamma
    Species: Enterobacter aerogenes [TaxId:548]
    Gene: ureA
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: urease subunit beta
    Species: Enterobacter aerogenes [TaxId:548]
    Gene: UREB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d4epdb_
  • Chain 'C':
    Compound: urease subunit alpha
    Species: Enterobacter aerogenes [TaxId:548]
    Gene: UREC
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4epdB (B:)
    mipgeyhvkpgqialntgratcrvvvenhgdrpiqvgshyhfaevnpalkfdrqqaagyr
    lnipagtavrfepgqkrevelvafaghravfgfrgevmgpl
    

  • Chain 'C':
    No sequence available.