PDB entry 4epb

View 4epb on RCSB PDB site
Description: Final Urease Structure for Radiation Damage Experiment at 100 K
Class: hydrolase
Keywords: alpha-beta barrel, nickel metalloenzyme, hydrolase, radiation damage
Deposited on 2012-04-17, released 2012-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-23, with a file datestamp of 2013-01-18.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.173
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Urease subunit gamma
    Species: Enterobacter aerogenes [TaxId:548]
    Gene: ureA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4epba_
  • Chain 'B':
    Compound: urease subunit beta
    Species: Enterobacter aerogenes [TaxId:548]
    Gene: UREB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4epbb_
  • Chain 'C':
    Compound: urease subunit alpha
    Species: Enterobacter aerogenes [TaxId:548]
    Gene: UREC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4epbc1, d4epbc2
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4epbA (A:)
    meltprekdklllftaalvaerrlarglklnypesvalisafimegardgksvaslmeeg
    rhvltreqvmegvpemipdiqveatfpdgsklvtvhnpii
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4epbB (B:)
    mipgeyhvkpgqialntgratcrvvvenhgdrpiqvgshyhfaevnpalkfdrqqaagyr
    lnipagtavrfepgqkrevelvafaghravfgfrgevmgpl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4epbC (C:)
    snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml
    aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa
    egkivtaggidthihwicpqqaeealvsgvttmvgggtgpaagthattctpgpwyisrml
    qaadslpvnigllgkgnvsqpdalreqvaagviglkihedwgatpaaidcaltvademdi
    qvalhsdtlnesgfvedtlaaiggrtihtfhtegaggghapdiitacahpnilpsstnpt
    lpytlntidehldmlmvchhldpdiaedvafaesrirretiaaedvlhdlgafsltssds
    qamgrvgevilrtwqvahrmkvqrgalaeetgdndnfrvkryiakytinpalthgiahev
    gsievgkladlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgalg
    sarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqty
    evrvdgelitsepadvlpmaqryflf