PDB entry 4ep6

View 4ep6 on RCSB PDB site
Description: Crystal structure of the XplA heme domain in complex with imidazole and PEG
Class: oxidoreductase
Keywords: P450 enzyme, P450 monoxygenase, explosive RDX, OXIDOREDUCTASE
Deposited on 2012-04-17, released 2012-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-06-20, with a file datestamp of 2012-06-15.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.203
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450-like protein xpla
    Species: Rhodococcus rhodochrous [TaxId:1829]
    Gene: xplA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ep6a_
  • Heterogens: HEM, IMD, 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ep6A (A:)
    aasidrelvpwsdpefrnnpypwyrrlqqdhpvhkledgtylvsryadvshfaklpimsv
    epgwadagpwavasdtalgsdpphhtvlrrqtnkwftpklvdgwvrttrelvgdlldgve
    agqviearrdlavvpthvtmarvlqlpeddadavmeamfeamlmqsaepadgdvdraava
    fgylsarvaemledkrvnpgdgladslldaarageiteseaiatilvfyavghmaigyli
    asgielfarrpevftafrndesaraaiinemvrmdppqlsflrfptedveiggvlieags
    pirfmigaanrdpevfddpdvfdhtrppaasrnlsfglgphscagqiisraeattvfavl
    aeryerielaeeptvahndfarryrklpivls