PDB entry 4ep5

View 4ep5 on RCSB PDB site
Description: Thermus thermophilus RuvC structure
Class: hydrolase
Keywords: resolvase, HYDROLASE
Deposited on 2012-04-17, released 2012-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-16, with a file datestamp of 2013-01-11.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: 0.213
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Crossover junction endodeoxyribonuclease RuvC
    Species: Thermus thermophilus [TaxId:300852]
    Gene: ruvC, TTHA1090
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SJC4 (0-165)
      • engineered mutation (145)
    Domains in SCOPe 2.07: d4ep5a_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ep5A (A:)
    mvvagidpgithlglgvvavegkgalkarllhgevvktspqepakervgriharvlevlh
    rfrpeavaveeqffyrqnelaykvgwalgavlvaafeagvpvyaygpmqvkqalaghgha
    akeevalmvrgilglkeaprpshlanalaialthafyarmgtakpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ep5A (A:)
    mvvagidpgithlglgvvavegkgalkarllhgevvktspqepakervgriharvlevlh
    rfrpeavaveeaykvgwalgavlvaafeagvpvyaygpmqvkqalaghghaakeevalmv
    rgilglkeaprpshlanalaialthafyarmgtakpl