PDB entry 4eoi

View 4eoi on RCSB PDB site
Description: Thr 160 phosphorylated CDK2 K89D, Q131E - human cyclin A3 complex with the inhibitor RO3306
Class: transferase/transferase inhibitor
Keywords: protein kinase, cell cycle, phosphorylation, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-04-14, released 2013-02-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-02-06, with a file datestamp of 2013-02-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.215
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclin-dependent kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK2, CDKN2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24941 (1-298)
      • expression tag (0)
      • engineered mutation (89)
      • engineered mutation (131)
    Domains in SCOPe 2.06: d4eoia1, d4eoia2
  • Chain 'B':
    Compound: Cyclin-A2
    Species: Homo sapiens [TaxId:9606]
    Gene: CCNA2, CCN1, CCNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4eoib1, d4eoib2
  • Chain 'C':
    Compound: cyclin-dependent kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK2, CDKN2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24941 (1-End)
      • expression tag (0)
      • engineered mutation (89)
      • engineered mutation (131)
    Domains in SCOPe 2.06: d4eoic1, d4eoic2
  • Chain 'D':
    Compound: Cyclin-A2
    Species: Homo sapiens [TaxId:9606]
    Gene: CCNA2, CCN1, CCNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4eoid1, d4eoid2
  • Heterogens: 1RO, DMS, SGM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4eoiA (A:)
    smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
    hpnivklldvihtenklylvfeflhqdlkdfmdasaltgiplpliksylfqllqglafch
    shrvlhrdlkpenllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
    ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykps
    fpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eoiA (A:)
    smenfqkvekigegtygvvykarnkltgevvalkkirlegvpstaireisllkelnhpni
    vklldvihtenklylvfeflhqdlkdfmdasaltgiplpliksylfqllqglafchshrv
    lhrdlkpenllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyysta
    vdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsfpkw
    arqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlrl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4eoiB (B:)
    vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl
    avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm
    ehlvlkvltfdlaaptvnqfltqyflhqqpanckveslamflgelslidadpylkylpsv
    iagaafhlalytvtgqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyk
    nskyhgvsllnppetlnl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4eoiC (C:)
    smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
    hpnivklldvihtenklylvfeflhqdlkdfmdasaltgiplpliksylfqllqglafch
    shrvlhrdlkpenllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
    ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykps
    fpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eoiC (C:)
    smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
    hpnivklldvihtenklylvfeflhqdlkdfmdasaltgiplpliksylfqllqglafch
    shrvlhrdlkpenllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
    ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykps
    fpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4eoiD (D:)
    vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl
    avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm
    ehlvlkvltfdlaaptvnqfltqyflhqqpanckveslamflgelslidadpylkylpsv
    iagaafhlalytvtgqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyk
    nskyhgvsllnppetlnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eoiD (D:)
    yhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavn
    yidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehl
    vlkvltfdlaaptvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviag
    aafhlalytvtgqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknsk
    yhgvsllnppetlnl