PDB entry 4eo7

View 4eo7 on RCSB PDB site
Description: Crystal structure of the TIR domain of human myeloid differentiation primary response protein 88.
Class: protein binding
Keywords: Adapter Protein, toll like receptor, BETA-ALPHA-BETA FOLD, PARALLEL BETA SHEET, TIR-Domain, Innate immune signaling, Signaling protein, TIRAP/MAL, PROTEIN BINDING
Deposited on 2012-04-13, released 2013-04-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-05-08, with a file datestamp of 2013-05-03.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.17
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myeloid differentiation primary response protein MyD88
    Species: Homo sapiens [TaxId:9606]
    Gene: MYD88
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99836 (4-143)
      • expression tag (0-3)
    Domains in SCOPe 2.08: d4eo7a1, d4eo7a2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4eo7A (A:)
    ggvdmperfdaficycpsdiqfvqemirqleqtnyrlklcvsdrdvlpgtcvwsiaseli
    ekrcrrmvvvvsddylqskecdfqtkfalslspgahqkrlipikykamkkefpsilrfit
    vcdytnpctkswfwtrlakalslp