PDB entry 4eo5

View 4eo5 on RCSB PDB site
Description: Yeast Asf1 bound to H3/H4G94P mutant
Class: structural protein/chaperone
Keywords: Ig-like domain, histone fold, Nucleosome assembly, histone chaperone, STRUCTURAL PROTEIN-CHAPERONE complex
Deposited on 2012-04-13, released 2012-06-13
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-06-13, with a file datestamp of 2012-06-08.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.206
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histone chaperone asf1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ASF1, CIA1, YJL115W, J0755
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32447 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.03: d4eo5a_
  • Chain 'B':
    Compound: Histone H3.2
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84233 (1-75)
      • expression tag (0)
      • engineered mutation (42)
    Domains in SCOPe 2.03: d4eo5b_
  • Chain 'C':
    Compound: histone h4
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62799 (0-82)
      • engineered mutation (74)
    Domains in SCOPe 2.03: d4eo5c_
  • Heterogens: ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4eo5A (A:)
    ssivsllgikvlnnpakftdpyefeitfecleslkhdlewkltyvgssrsldhdqeldsi
    lvgpvpvgvnkfvfsadppsaelipaselvsvtvillscsydgrefvrvgyyvnneydee
    elrenppakvqvdhivrnilaekprvtrfnivwdnenegdlyppeqpgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eo5A (A:)
    ssivsllgikvlnnpakftdpyefeitfecleslkhdlewkltyvgssrsldhdqeldsi
    lvgpvpvgvnkfvfsadppsaelipaselvsvtvillscsydgrefvrvgyyvnneydee
    elrenppakvqvdhivrnilaekprvtrfnivwdngdlypp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4eo5B (B:)
    alirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvti
    mpkdiqlarrirgera
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4eo5C (C:)
    kvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrk
    tvtamdvvyalkrqprtlygfgg