PDB entry 4eo4

View 4eo4 on RCSB PDB site
Description: Crystal structure of the yeast mitochondrial threonyl-tRNA synthetase (MST1) in complex with seryl sulfamoyl adenylate
Class: ligase
Keywords: aminoacyl-tRNA synthetase class II, threonyl-tRNA synthetase, threonine tRNA, mitochondria, ligase
Deposited on 2012-04-13, released 2012-07-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-01-02, with a file datestamp of 2012-12-28.
Experiment type: XRAY
Resolution: 2.87 Å
R-factor: 0.178
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Threonine--tRNA ligase, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: MST1, YKL194C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4eo4a1, d4eo4a2
  • Chain 'B':
    Compound: Threonine--tRNA ligase, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: MST1, YKL194C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4eo4b1, d4eo4b2
  • Chain 'C':
    Compound: Threonine--tRNA ligase, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: MST1, YKL194C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4eo4c1, d4eo4c2
  • Chain 'D':
    Compound: Threonine--tRNA ligase, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: MST1, YKL194C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4eo4d1, d4eo4d2
  • Heterogens: SSA, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4eo4A (A:)
    mgsshhhhhhssglvprgshmasatknassatpatmtsmvsqrqdlfmtdplspgsmffl
    pngakifnkliefmklqqkfkfgfnevvtpliykktlweksghwenyaddmfkvettdee
    keeyglkpmncpghclifgkkdrsynelplrfsdfsplhrneasgalsgltrlrkfhqdd
    ghifctpsqvkseifnslklidivynkifpfvkggsgaesnyfinfstrpdhfigdlkvw
    nhaeqvlkeileesgkpwklnpgdgafygpkldimvtdhlrkthqvatiqldfqlperfd
    lkfkdqdnsykrpimihratfgsierfmallidsnegrwpfwlnpyqaviipvntknvqq
    ldmctalqkklrneleaddmepvplndwhfnvdldirnepvgyriksailknysyliivg
    deevqlqkynirerdnrksfekltmsqiwekfieleknyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eo4A (A:)
    atmtsmvsqrqdlfmtdplspgsmfflpngakifnkliefmklqqkfkfgfnevvtpliy
    kktlweksghwenyaddmfkvetkeeyglkpmncpghclifgkkdrsynelplrfsdfsp
    lhrneasgalsgltrlrkfhqddghifctpsqvkseifnslklidivynkifpfaesnyf
    infstrpdhfigdlkvwnhaeqvlkeileesgkpwklnpgdgafygpkldimvtdhlrkt
    hqvatiqldfqlperfdlkfkdqdnsykrpimihratfgsierfmallidsnegrwpfwl
    npyqaviipvntknvqqldmctalqkklrneleaddmepvplndwhfnvdldirnepvgy
    riksailknysyliivgdeevqlqkynirerdnrksfekltmsqiwekfieleknyk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4eo4B (B:)
    mgsshhhhhhssglvprgshmasatknassatpatmtsmvsqrqdlfmtdplspgsmffl
    pngakifnkliefmklqqkfkfgfnevvtpliykktlweksghwenyaddmfkvettdee
    keeyglkpmncpghclifgkkdrsynelplrfsdfsplhrneasgalsgltrlrkfhqdd
    ghifctpsqvkseifnslklidivynkifpfvkggsgaesnyfinfstrpdhfigdlkvw
    nhaeqvlkeileesgkpwklnpgdgafygpkldimvtdhlrkthqvatiqldfqlperfd
    lkfkdqdnsykrpimihratfgsierfmallidsnegrwpfwlnpyqaviipvntknvqq
    ldmctalqkklrneleaddmepvplndwhfnvdldirnepvgyriksailknysyliivg
    deevqlqkynirerdnrksfekltmsqiwekfieleknyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eo4B (B:)
    mtsmvsqrqdlfmtdplspgsmfflpngakifnkliefmklqqkfkfgfnevvtpliykk
    tlweksghwenyaddmfkvetkeeyglkpmncpghclifgkkdrsynelplrfsdfsplh
    rneasgalsgltrlrkfhqddghifctpsqvkseifnslklidivynkifpfsnyfinfs
    trpdhfigdlkvwnhaeqvlkeileesgkpwklnpgdgafygpkldimvtdhlrkthqva
    tiqldfqlperfdlkfkdqdnsykrpimihratfgsierfmallidsnegrwpfwlnpyq
    aviipvntknvqqldmctalqkklrneleaddmepvplndwhfnvdldirnepvgyriks
    ailknysyliivgdeevqlqkynirerdnrksfekltmsqiwekfieleknyk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4eo4C (C:)
    mgsshhhhhhssglvprgshmasatknassatpatmtsmvsqrqdlfmtdplspgsmffl
    pngakifnkliefmklqqkfkfgfnevvtpliykktlweksghwenyaddmfkvettdee
    keeyglkpmncpghclifgkkdrsynelplrfsdfsplhrneasgalsgltrlrkfhqdd
    ghifctpsqvkseifnslklidivynkifpfvkggsgaesnyfinfstrpdhfigdlkvw
    nhaeqvlkeileesgkpwklnpgdgafygpkldimvtdhlrkthqvatiqldfqlperfd
    lkfkdqdnsykrpimihratfgsierfmallidsnegrwpfwlnpyqaviipvntknvqq
    ldmctalqkklrneleaddmepvplndwhfnvdldirnepvgyriksailknysyliivg
    deevqlqkynirerdnrksfekltmsqiwekfieleknyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eo4C (C:)
    atmtsmvsqrqdlfmtdplspgsmfflpngakifnkliefmklqqkfkfgfnevvtpliy
    kktlweksghwenyaddmfkvettekeeyglkpmncpghclifgkkdrsynelplrfsdf
    splhrneasgalsgltrlrkfhqddghifctpsqvkseifnslklidivynkifpsnyfi
    nfstrpdhfigdlkvwnhaeqvlkeileesgkpwklnpgdgafygpkldimvtdhlrkth
    qvatiqldfqlperfdlkfkdqdnsykrpimihratfgsierfmallidsnegrwpfwln
    pyqaviipvntknvqqldmctalqkklrneleaddmepvplndwhfnvdldirnepvgyr
    iksailknysyliivgdeevqlqkynirerdnrksfekltmsqiwekfieleknyk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4eo4D (D:)
    mgsshhhhhhssglvprgshmasatknassatpatmtsmvsqrqdlfmtdplspgsmffl
    pngakifnkliefmklqqkfkfgfnevvtpliykktlweksghwenyaddmfkvettdee
    keeyglkpmncpghclifgkkdrsynelplrfsdfsplhrneasgalsgltrlrkfhqdd
    ghifctpsqvkseifnslklidivynkifpfvkggsgaesnyfinfstrpdhfigdlkvw
    nhaeqvlkeileesgkpwklnpgdgafygpkldimvtdhlrkthqvatiqldfqlperfd
    lkfkdqdnsykrpimihratfgsierfmallidsnegrwpfwlnpyqaviipvntknvqq
    ldmctalqkklrneleaddmepvplndwhfnvdldirnepvgyriksailknysyliivg
    deevqlqkynirerdnrksfekltmsqiwekfieleknyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eo4D (D:)
    atmtsmvsqrqdlfmtdplspgsmfflpngakifnkliefmklqqkfkfgfnevvtpliy
    kktlweksghwenyaddmfkvetkeeyglkpmncpghclifgkkdrsynelplrfsdfsp
    lhrneasgalsgltrlrkfhqddghifctpsqvkseifnslklidivynkifpsnyfinf
    strpdhfigdlkvwnhaeqvlkeileesgkpwklnpgdgafygpkldimvtdhlrkthqv
    atiqldfqlperfdlkfkdqdnsykrpimihratfgsierfmallidsnegrwpfwlnpy
    qaviipvntknvqqldmctalqkklrneleaddmepvplndwhfnvdldirnepvgyrik
    sailknysyliivgdeevqlqkynirerdnrksfekltmsqiwekfieleknyk