PDB entry 4eny

View 4eny on RCSB PDB site
Description: Crystal Structure of Pim-1 kinase in complex with (2E,5Z)-2-(2-chlorophenylimino)-5-(4-hydroxy-3-methoxybenzylidene)thiazolidin-4-one
Class: transferase/inhibitor
Keywords: Pim-1 kinase, TRANSFERASE-INHIBITOR complex
Deposited on 2012-04-13, released 2012-08-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-10-03, with a file datestamp of 2012-09-28.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.175
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase pim-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PIM1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4enya_
  • Heterogens: DMS, GOL, PO4, J19, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4enyA (A:)
    mkekeplesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvp
    mevvllkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsf
    fwqvleavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvy
    sppewiryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhli
    rwclalrpsdrptfeeiqnhpwmqdvllpqetaeihlhslspgpsksgpssgenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4enyA (A:)
    qyqvgpllgsgfgsvysgirvsdnlpvaikhvekdrisdwgrvpmevvllkkvssfsgvi
    rlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvleavrhchncgvl
    hrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppewiryhryhgrsaa
    vwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwclalrpsdrptfeei
    qnhpwmqdvllpqetaeihlh