PDB entry 4enw

View 4enw on RCSB PDB site
Description: Structure of the S234N variant of E. coli KatE
Class: oxidoreductase
Keywords: catalase fold, KatE, S234N variant, OXIDOREDUCTASE
Deposited on 2012-04-13, released 2012-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-27, with a file datestamp of 2013-02-22.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.177
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: catalase hpii
    Species: Escherichia coli [TaxId:83333]
    Gene: b1732, JW1721, katE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21179 (Start-752)
      • engineered mutation (233)
    Domains in SCOPe 2.07: d4enwa1, d4enwa2
  • Chain 'B':
    Compound: catalase hpii
    Species: Escherichia coli [TaxId:83333]
    Gene: b1732, JW1721, katE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21179 (Start-752)
      • engineered mutation (233)
    Domains in SCOPe 2.07: d4enwb1, d4enwb2
  • Chain 'C':
    Compound: catalase hpii
    Species: Escherichia coli [TaxId:83333]
    Gene: b1732, JW1721, katE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21179 (Start-752)
      • engineered mutation (233)
    Domains in SCOPe 2.07: d4enwc1, d4enwc2
  • Chain 'D':
    Compound: catalase hpii
    Species: Escherichia coli [TaxId:83333]
    Gene: b1732, JW1721, katE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21179 (Start-752)
      • engineered mutation (233)
    Domains in SCOPe 2.07: d4enwd1, d4enwd2
  • Heterogens: HDD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4enwA (A:)
    msqhneknphqhqsplhdsseakpgmdslapedgshrpaaeptppgaqptapgslkapdt
    rneklnsledvrkgsenyalttnqgvriaddqnslragsrgptlledfilrekithfdhe
    riperivhargsaahgyfqpykslsditkadflsdpnkitpvfvrfstvqggagsadtvr
    dirgfatkfyteegifdlvgnntpiffiqdahkfpdfvhavkpephwaipqgqnahdtfw
    dyvslqpetlhnvmwamsdrgiprsyrtmegfgihtfrlinaegkatfvrfhwkplagka
    slvwdeaqkltgrdpdfhrrelweaieagdfpeyelgfqlipeedefkfdfdlldptkli
    peelvpvqrvgkmvlnrnpdnffaeneqaafhpghivpgldftndpllqgrlfsytdtqi
    srlggpnfheipinrptcpyhnfqrdgmhrmgidtnpanyepnsindnwpretppgpkrg
    gfesyqervegnkvrerspsfgeyyshprlfwlsqtpfeqrhivdgfsfelskvvrpyir
    ervvdqlahidltlaqavaknlgieltddqlnitpppdvnglkkdpslslyaipdgdvkg
    rvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfagapsl
    tvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeegive
    adsadgsfmdelltlmaahrvwsripkidkipa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4enwA (A:)
    slapedgshrpaaeptppgaqptapgslkapdtrneklnsledvrkgsenyalttnqgvr
    iaddqnslragsrgptlledfilrekithfdheriperivhargsaahgyfqpykslsdi
    tkadflsdpnkitpvfvrfstvqggagsadtvrdirgfatkfyteegifdlvgnntpiff
    iqdahkfpdfvhavkpephwaipqgqnahdtfwdyvslqpetlhnvmwamsdrgiprsyr
    tmegfgihtfrlinaegkatfvrfhwkplagkaslvwdeaqkltgrdpdfhrrelweaie
    agdfpeyelgfqlipeedefkfdfdlldptklipeelvpvqrvgkmvlnrnpdnffaene
    qaafhpghivpgldftndpllqgrlfsytdtqisrlggpnfheipinrptcpyhnfqrdg
    mhrmgidtnpanyepnsindnwpretppgpkrggfesyqervegnkvrerspsfgeyysh
    prlfwlsqtpfeqrhivdgfsfelskvvrpyirervvdqlahidltlaqavaknlgielt
    ddqlnitpppdvnglkkdpslslyaipdgdvkgrvvaillndevrsadllailkalkakg
    vhakllysrmgevtaddgtvlpiaatfagapsltvdavivpcgniadiadngdanyylme
    aykhlkpialagdarkfkatikiadqgeegiveadsadgsfmdelltlmaahrvwsripk
    idkipa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4enwB (B:)
    msqhneknphqhqsplhdsseakpgmdslapedgshrpaaeptppgaqptapgslkapdt
    rneklnsledvrkgsenyalttnqgvriaddqnslragsrgptlledfilrekithfdhe
    riperivhargsaahgyfqpykslsditkadflsdpnkitpvfvrfstvqggagsadtvr
    dirgfatkfyteegifdlvgnntpiffiqdahkfpdfvhavkpephwaipqgqnahdtfw
    dyvslqpetlhnvmwamsdrgiprsyrtmegfgihtfrlinaegkatfvrfhwkplagka
    slvwdeaqkltgrdpdfhrrelweaieagdfpeyelgfqlipeedefkfdfdlldptkli
    peelvpvqrvgkmvlnrnpdnffaeneqaafhpghivpgldftndpllqgrlfsytdtqi
    srlggpnfheipinrptcpyhnfqrdgmhrmgidtnpanyepnsindnwpretppgpkrg
    gfesyqervegnkvrerspsfgeyyshprlfwlsqtpfeqrhivdgfsfelskvvrpyir
    ervvdqlahidltlaqavaknlgieltddqlnitpppdvnglkkdpslslyaipdgdvkg
    rvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfagapsl
    tvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeegive
    adsadgsfmdelltlmaahrvwsripkidkipa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4enwB (B:)
    slapedgshrpaaeptppgaqptapgslkapdtrneklnsledvrkgsenyalttnqgvr
    iaddqnslragsrgptlledfilrekithfdheriperivhargsaahgyfqpykslsdi
    tkadflsdpnkitpvfvrfstvqggagsadtvrdirgfatkfyteegifdlvgnntpiff
    iqdahkfpdfvhavkpephwaipqgqnahdtfwdyvslqpetlhnvmwamsdrgiprsyr
    tmegfgihtfrlinaegkatfvrfhwkplagkaslvwdeaqkltgrdpdfhrrelweaie
    agdfpeyelgfqlipeedefkfdfdlldptklipeelvpvqrvgkmvlnrnpdnffaene
    qaafhpghivpgldftndpllqgrlfsytdtqisrlggpnfheipinrptcpyhnfqrdg
    mhrmgidtnpanyepnsindnwpretppgpkrggfesyqervegnkvrerspsfgeyysh
    prlfwlsqtpfeqrhivdgfsfelskvvrpyirervvdqlahidltlaqavaknlgielt
    ddqlnitpppdvnglkkdpslslyaipdgdvkgrvvaillndevrsadllailkalkakg
    vhakllysrmgevtaddgtvlpiaatfagapsltvdavivpcgniadiadngdanyylme
    aykhlkpialagdarkfkatikiadqgeegiveadsadgsfmdelltlmaahrvwsripk
    idkipa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4enwC (C:)
    msqhneknphqhqsplhdsseakpgmdslapedgshrpaaeptppgaqptapgslkapdt
    rneklnsledvrkgsenyalttnqgvriaddqnslragsrgptlledfilrekithfdhe
    riperivhargsaahgyfqpykslsditkadflsdpnkitpvfvrfstvqggagsadtvr
    dirgfatkfyteegifdlvgnntpiffiqdahkfpdfvhavkpephwaipqgqnahdtfw
    dyvslqpetlhnvmwamsdrgiprsyrtmegfgihtfrlinaegkatfvrfhwkplagka
    slvwdeaqkltgrdpdfhrrelweaieagdfpeyelgfqlipeedefkfdfdlldptkli
    peelvpvqrvgkmvlnrnpdnffaeneqaafhpghivpgldftndpllqgrlfsytdtqi
    srlggpnfheipinrptcpyhnfqrdgmhrmgidtnpanyepnsindnwpretppgpkrg
    gfesyqervegnkvrerspsfgeyyshprlfwlsqtpfeqrhivdgfsfelskvvrpyir
    ervvdqlahidltlaqavaknlgieltddqlnitpppdvnglkkdpslslyaipdgdvkg
    rvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfagapsl
    tvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeegive
    adsadgsfmdelltlmaahrvwsripkidkipa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4enwC (C:)
    slapedgshrpaaeptppgaqptapgslkapdtrneklnsledvrkgsenyalttnqgvr
    iaddqnslragsrgptlledfilrekithfdheriperivhargsaahgyfqpykslsdi
    tkadflsdpnkitpvfvrfstvqggagsadtvrdirgfatkfyteegifdlvgnntpiff
    iqdahkfpdfvhavkpephwaipqgqnahdtfwdyvslqpetlhnvmwamsdrgiprsyr
    tmegfgihtfrlinaegkatfvrfhwkplagkaslvwdeaqkltgrdpdfhrrelweaie
    agdfpeyelgfqlipeedefkfdfdlldptklipeelvpvqrvgkmvlnrnpdnffaene
    qaafhpghivpgldftndpllqgrlfsytdtqisrlggpnfheipinrptcpyhnfqrdg
    mhrmgidtnpanyepnsindnwpretppgpkrggfesyqervegnkvrerspsfgeyysh
    prlfwlsqtpfeqrhivdgfsfelskvvrpyirervvdqlahidltlaqavaknlgielt
    ddqlnitpppdvnglkkdpslslyaipdgdvkgrvvaillndevrsadllailkalkakg
    vhakllysrmgevtaddgtvlpiaatfagapsltvdavivpcgniadiadngdanyylme
    aykhlkpialagdarkfkatikiadqgeegiveadsadgsfmdelltlmaahrvwsripk
    idkipa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4enwD (D:)
    msqhneknphqhqsplhdsseakpgmdslapedgshrpaaeptppgaqptapgslkapdt
    rneklnsledvrkgsenyalttnqgvriaddqnslragsrgptlledfilrekithfdhe
    riperivhargsaahgyfqpykslsditkadflsdpnkitpvfvrfstvqggagsadtvr
    dirgfatkfyteegifdlvgnntpiffiqdahkfpdfvhavkpephwaipqgqnahdtfw
    dyvslqpetlhnvmwamsdrgiprsyrtmegfgihtfrlinaegkatfvrfhwkplagka
    slvwdeaqkltgrdpdfhrrelweaieagdfpeyelgfqlipeedefkfdfdlldptkli
    peelvpvqrvgkmvlnrnpdnffaeneqaafhpghivpgldftndpllqgrlfsytdtqi
    srlggpnfheipinrptcpyhnfqrdgmhrmgidtnpanyepnsindnwpretppgpkrg
    gfesyqervegnkvrerspsfgeyyshprlfwlsqtpfeqrhivdgfsfelskvvrpyir
    ervvdqlahidltlaqavaknlgieltddqlnitpppdvnglkkdpslslyaipdgdvkg
    rvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfagapsl
    tvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeegive
    adsadgsfmdelltlmaahrvwsripkidkipa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4enwD (D:)
    slapedgshrpaaeptppgaqptapgslkapdtrneklnsledvrkgsenyalttnqgvr
    iaddqnslragsrgptlledfilrekithfdheriperivhargsaahgyfqpykslsdi
    tkadflsdpnkitpvfvrfstvqggagsadtvrdirgfatkfyteegifdlvgnntpiff
    iqdahkfpdfvhavkpephwaipqgqnahdtfwdyvslqpetlhnvmwamsdrgiprsyr
    tmegfgihtfrlinaegkatfvrfhwkplagkaslvwdeaqkltgrdpdfhrrelweaie
    agdfpeyelgfqlipeedefkfdfdlldptklipeelvpvqrvgkmvlnrnpdnffaene
    qaafhpghivpgldftndpllqgrlfsytdtqisrlggpnfheipinrptcpyhnfqrdg
    mhrmgidtnpanyepnsindnwpretppgpkrggfesyqervegnkvrerspsfgeyysh
    prlfwlsqtpfeqrhivdgfsfelskvvrpyirervvdqlahidltlaqavaknlgielt
    ddqlnitpppdvnglkkdpslslyaipdgdvkgrvvaillndevrsadllailkalkakg
    vhakllysrmgevtaddgtvlpiaatfagapsltvdavivpcgniadiadngdanyylme
    aykhlkpialagdarkfkatikiadqgeegiveadsadgsfmdelltlmaahrvwsripk
    idkipa