PDB entry 4eno

View 4eno on RCSB PDB site
Description: Crystal structure of oxidized human nm23-H1
Class: transferase
Keywords: Ferredoxin-like/Alpha, beta proteins, nucleoside diphosphate kinase, TRANSFERASE
Deposited on 2012-04-13, released 2013-03-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-03-27, with a file datestamp of 2013-03-22.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.19
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside Diphosphate Kinase A
    Species: Homo sapiens [TaxId:9606]
    Gene: NME1, NDPKA, NM23
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4enoa_
  • Chain 'B':
    Compound: Nucleoside Diphosphate Kinase A
    Species: Homo sapiens [TaxId:9606]
    Gene: NME1, NDPKA, NM23
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4enob_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4enoA (A:)
    mancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpf
    faglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgs
    dsvesaekeiglwfhpeelvdytscaqnwiye
    

    Sequence, based on observed residues (ATOM records): (download)
    >4enoA (A:)
    mancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpf
    faglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgs
    dsvesaekeiglwfhpeelvdytscaqnwiy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4enoB (B:)
    mancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpf
    faglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgs
    dsvesaekeiglwfhpeelvdytscaqnwiye
    

    Sequence, based on observed residues (ATOM records): (download)
    >4enoB (B:)
    mancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpf
    faglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgs
    dsvesaekeiglwfhpeelvdytscaqnw