PDB entry 4ene

View 4ene on RCSB PDB site
Description: Structure of the N- and C-terminal trimmed ClC-ec1 Cl-/H+ antiporter and Fab Complex
Class: transport protein
Keywords: membrane protein, coupled ion transporter, cell membrane, TRANSPORT PROTEIN
Deposited on 2012-04-13, released 2012-12-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-12-26, with a file datestamp of 2012-12-21.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.241
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H(+)/Cl(-) exchange transporter clcA
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: clcA, eriC, yadQ, b0155, JW5012
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4enea_
  • Chain 'B':
    Compound: H(+)/Cl(-) exchange transporter clcA
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: clcA, eriC, yadQ, b0155, JW5012
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4eneb_
  • Chain 'C':
    Compound: heavy chain of Fab fragment
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4ENE (0-221)
    Domains in SCOPe 2.06: d4enec1, d4enec2
  • Chain 'D':
    Compound: light chain of Fab fragment
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4ENE (0-210)
    Domains in SCOPe 2.06: d4ened1, d4ened2
  • Chain 'E':
    Compound: heavy chain of Fab fragment
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4ENE (Start-221)
    Domains in SCOPe 2.06: d4enee1, d4enee2
  • Chain 'F':
    Compound: light chain of Fab fragment
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4ENE (0-210)
    Domains in SCOPe 2.06: d4enef1, d4enef2
  • Heterogens: CL, DMU, MAL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4eneA (A:)
    mrrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadny
    pllltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffgg
    lgtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnapla
    gilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwly
    lilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsgg
    gfnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmva
    velfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatll
    aqftggkplysailartlakqeaeqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eneA (A:)
    rrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnyp
    llltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffggl
    gtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplag
    ilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyl
    ilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsggg
    fnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvav
    elfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatlla
    qftggkplysailartlakqeaeq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4eneB (B:)
    mrrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadny
    pllltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffgg
    lgtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnapla
    gilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwly
    lilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsgg
    gfnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmva
    velfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatll
    aqftggkplysailartlakqeaeqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eneB (B:)
    rrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnyp
    llltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffggl
    gtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplag
    ilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyl
    ilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsggg
    fnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvav
    elfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatlla
    qftggkplysailartlakqea
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4eneC (C:)
    evrllesggglvqpggslklscaasgfdysrywmswvrqapgkglkwigeinpvsstiny
    tpslkdkfiisrdnakdtlylqiskvrsedtalyycarlyygygywyfdvwgagttvtvs
    sakttppsvyplapgsaaaaasmvtlgclvkgyfpepvtvtwnsgslaagvhtfpavlqa
    alytlsssvtvpssswpsetvtcnvahpasstkvdkkivpra
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4eneD (D:)
    divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
    fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleilradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnra
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4eneE (E:)
    evrllesggglvqpggslklscaasgfdysrywmswvrqapgkglkwigeinpvsstiny
    tpslkdkfiisrdnakdtlylqiskvrsedtalyycarlyygygywyfdvwgagttvtvs
    sakttppsvyplapgsaaaaasmvtlgclvkgyfpepvtvtwnsgslaagvhtfpavlqa
    alytlsssvtvpssswpsetvtcnvahpasstkvdkkivpra
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eneE (E:)
    vrllesggglvqpggslklscaasgfdysrywmswvrqapgkglkwigeinpvsstinyt
    pslkdkfiisrdnakdtlylqiskvrsedtalyycarlyygygywyfdvwgagttvtvss
    akttppsvyplapgsaaaaasmvtlgclvkgyfpepvtvtwnsgslaagvhtfpavlqaa
    lytlsssvtvpssswpsetvtcnvahpasstkvdkkivpra
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4eneF (F:)
    divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
    fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleilradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnra