PDB entry 4en4

View 4en4 on RCSB PDB site
Description: Crystal Structure of the Ternary Human PL Kinase-Ginkgotoxin-MgATP Complex
Class: transferase/transferase inhibitor
Keywords: TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-04-12, released 2012-05-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-08-22, with a file datestamp of 2012-08-17.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.219
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyridoxal kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: PDXK, C21orf124, C21orf97, PKH, PNK, PRED79
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4en4a_
  • Chain 'B':
    Compound: Pyridoxal kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: PDXK, C21orf124, C21orf97, PKH, PNK, PRED79
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4en4b_
  • Heterogens: MG, NA, ATP, GT0, MPD, SO4, GT1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4en4A (A:)
    meeecrvlsiqshvirgyvgnraatfplqvlgfeidavnsvqfsnhtgyahwkgqvlnsd
    elqelyeglrlnnmnkydyvltgytrdksflamvvdivqelkqqnprlvyvcdpvlgdkw
    dgegsmyvpedllpvykekvvpladiitpnqfeaellsgrkihsqeealrvmdmlhsmgp
    dtvvitssdlpspqgsnylivlgsqrrrnpagsvvmerirmdirkvdavfvgtgdlfaam
    llawthkhpnnlkvacektvstlhhvlqrtiqcakaqagegvrpspmqlelrmvqskrdi
    edpeivvqatvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4en4A (A:)
    eecrvlsiqshvirgyvgnraatfplqvlgfeidavnsvqfsnhtgyahwkgqvlnsdel
    qelyeglrlnnmnkydyvltgytrdksflamvvdivqelkqqnprlvyvcdpvlgdkwdg
    egsmyvpedllpvykekvvpladiitpnqfeaellsgrkihsqeealrvmdmlhsmgpdt
    vvitssdlpspqgsnylivlgsqrrrnpagsvvmerirmdirkvdavfvgtgdlfaamll
    awthkhpnnlkvacektvstlhhvlqrtiqcakaqagegvrpspmqlelrmvqskrdied
    peivvqatvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4en4B (B:)
    meeecrvlsiqshvirgyvgnraatfplqvlgfeidavnsvqfsnhtgyahwkgqvlnsd
    elqelyeglrlnnmnkydyvltgytrdksflamvvdivqelkqqnprlvyvcdpvlgdkw
    dgegsmyvpedllpvykekvvpladiitpnqfeaellsgrkihsqeealrvmdmlhsmgp
    dtvvitssdlpspqgsnylivlgsqrrrnpagsvvmerirmdirkvdavfvgtgdlfaam
    llawthkhpnnlkvacektvstlhhvlqrtiqcakaqagegvrpspmqlelrmvqskrdi
    edpeivvqatvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4en4B (B:)
    eecrvlsiqshvirgyvgnraatfplqvlgfeidavnsvqfsnhtgyahwkgqvlnsdel
    qelyeglrlnnmnkydyvltgytrdksflamvvdivqelkqqnprlvyvcdpvlgdkwdg
    egsmyvpedllpvykekvvpladiitpnqfeaellsgrkihsqeealrvmdmlhsmgpdt
    vvitssdlpspqgsnylivlgsqrrrnpagsvvmerirmdirkvdavfvgtgdlfaamll
    awthkhpnnlkvacektvstlhhvlqrtiqcakaqagegvrpspmqlelrmvqskrdied
    peivvqatvl