PDB entry 4emz

View 4emz on RCSB PDB site
Description: HIV-1 Nef in complex with MHC-I cytoplasmic domain and Mu1 adaptin subunit of AP1 adaptor (second domain)
Class: viral protein/immune system
Keywords: Human immunodeficiency virus 1, HIV, Nef, MHC-I, antigen presentation, host defense, Adaptor protein complex 1, Mu1 adaptin subunit, sorting motif recognition, CLASP, membrane trafficking, viral hijacking, VIRAL PROTEIN-IMMUNE SYSTEM complex
Deposited on 2012-04-12, released 2012-06-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-07-25, with a file datestamp of 2012-07-20.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.225
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: AP-1 complex subunit mu-1
    Species: Mus musculus [TaxId:10090]
    Gene: Ap1m1, Cltnm
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4emza_
  • Chain 'B':
    Compound: Protein Nef
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: nef
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Protein Nef
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: nef
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: MHC-I
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-2
    Database cross-references and differences (RAF-indexed):
    • PDB 4EMZ (0-End)
  • Chain 'E':
    Compound: MHC-I
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-2
    Database cross-references and differences (RAF-indexed):
    • PDB 4EMZ
  • Chain 'M':
    Compound: AP-1 complex subunit mu-1
    Species: Mus musculus [TaxId:10090]
    Gene: Ap1m1, Cltnm
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4emzm_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4emzA (A:)
    swrsegikyrknevfldvieavnllvsangnvlrseivgsikmrvflsgmpelrlglndk
    vlfdntgrgksksveledvkfhqcvrlsrfendrtisfippdgefelmsyrlnthvkpli
    wiesviekhshsrieymvkaksqfkrrstannveihipvpndadspkfkttvgsvkwvpe
    nseivwsvksfpggkeylmrahfglpsveaedkegkppisvkfeipyfttsgiqvrylki
    ieksgyqalpwvryitqngdyqlrtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emzA (A:)
    wrsegikyrknevfldvieavnllvsangnvlrseivgsikmrvflsgmpelrlglndkv
    lfdntgrgksksveledvkfhqcvrlsrfendrtisfippdgefelmsyrlnthvkpliw
    iesviekhshsrieymvkaksqfkrrstannveihipvpndadspkfkttvgsvkwvpen
    seivwsvksfpggkeylmrahfglkppisvkfeipyfttsgiqvrylkiieksgyqalpw
    vryitqngdyqlrtq
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4emzM (M:)
    swrsegikyrknevfldvieavnllvsangnvlrseivgsikmrvflsgmpelrlglndk
    vlfdntgrgksksveledvkfhqcvrlsrfendrtisfippdgefelmsyrlnthvkpli
    wiesviekhshsrieymvkaksqfkrrstannveihipvpndadspkfkttvgsvkwvpe
    nseivwsvksfpggkeylmrahfglpsveaedkegkppisvkfeipyfttsgiqvrylki
    ieksgyqalpwvryitqngdyqlrtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emzM (M:)
    wrsegikyrknevfldvieavnllvsangnvlrseivgsikmrvflsgmpelrlglndkv
    lfdntgrgksksveledvkfhqcvrlsrfendrtisfippdgefelmsyrlnthvkpliw
    iesviekhshsrieymvkaksqfkrrstannveihipvpndadspkfkttvgsvkwvpen
    seivwsvksfpggkeylmrahfglkppisvkfeipyfttsgiqvrylkiieksgyqalpw
    vryitqngdyqlrtq