PDB entry 4emq

View 4emq on RCSB PDB site
Description: Crystal structure of a single mutant of Dronpa, the green-on-state PDM1-4
Class: fluorescent protein
Keywords: dronpa, gfp-like protein, reversible photoswitchable fluorescent protein, beta barrel, fluorescent protein
Deposited on 2012-04-12, released 2012-11-21
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-01-23, with a file datestamp of 2013-01-18.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.186
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene: Dronpa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6
      • chromophore (95)
      • engineered mutation (177)
    Domains in SCOPe 2.03: d4emqa_
  • Chain 'B':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene: Dronpa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6
      • chromophore (95)
      • engineered mutation (177)
    Domains in SCOPe 2.03: d4emqb_
  • Chain 'C':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene: Dronpa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6
      • chromophore (95)
      • engineered mutation (177)
    Domains in SCOPe 2.03: d4emqc_
  • Chain 'D':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene: Dronpa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6
      • chromophore (95)
      • engineered mutation (177)
    Domains in SCOPe 2.03: d4emqd_
  • Chain 'E':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene: Dronpa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6
      • chromophore (95)
      • engineered mutation (177)
    Domains in SCOPe 2.03: d4emqe_
  • Chain 'F':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene: Dronpa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6
      • chromophore (95)
      • engineered mutation (177)
    Domains in SCOPe 2.03: d4emqf_
  • Heterogens: EPE, 1PE, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4emqA (A:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdpmsvikpdmkiklrmegavnghpfaieg
    vglgkpfegkqsmdlkvkeggplpfaydilttvfcygnrvfakypenivdyfkqsfpegy
    swersmnyedggicnatnditldgdcyiyeirfdgvnfpangpvmqkrtvkwepstenly
    vrdgvlkgdvnmalsleggghyrcdfkttykakkvvqlpdyhfvdhhieikshdkdysnv
    nlhehaeahselprqak
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emqA (A:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    cygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepstenlyvrdgvlkgdvnmalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahse
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4emqB (B:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdpmsvikpdmkiklrmegavnghpfaieg
    vglgkpfegkqsmdlkvkeggplpfaydilttvfcygnrvfakypenivdyfkqsfpegy
    swersmnyedggicnatnditldgdcyiyeirfdgvnfpangpvmqkrtvkwepstenly
    vrdgvlkgdvnmalsleggghyrcdfkttykakkvvqlpdyhfvdhhieikshdkdysnv
    nlhehaeahselprqak
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emqB (B:)
    vikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvfc
    ygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfdg
    vnfpangpvmqkrtvkwepstenlyvrdgvlkgdvnmalsleggghyrcdfkttykakkv
    vqlpdyhfvdhhieikshdkdysnvnlhehaeahse
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4emqC (C:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdpmsvikpdmkiklrmegavnghpfaieg
    vglgkpfegkqsmdlkvkeggplpfaydilttvfcygnrvfakypenivdyfkqsfpegy
    swersmnyedggicnatnditldgdcyiyeirfdgvnfpangpvmqkrtvkwepstenly
    vrdgvlkgdvnmalsleggghyrcdfkttykakkvvqlpdyhfvdhhieikshdkdysnv
    nlhehaeahselprqak
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emqC (C:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    cygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepstenlyvrdgvlkgdvnmalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4emqD (D:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdpmsvikpdmkiklrmegavnghpfaieg
    vglgkpfegkqsmdlkvkeggplpfaydilttvfcygnrvfakypenivdyfkqsfpegy
    swersmnyedggicnatnditldgdcyiyeirfdgvnfpangpvmqkrtvkwepstenly
    vrdgvlkgdvnmalsleggghyrcdfkttykakkvvqlpdyhfvdhhieikshdkdysnv
    nlhehaeahselprqak
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emqD (D:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    cygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepstenlyvrdgvlkgdvnmalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahse
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4emqE (E:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdpmsvikpdmkiklrmegavnghpfaieg
    vglgkpfegkqsmdlkvkeggplpfaydilttvfcygnrvfakypenivdyfkqsfpegy
    swersmnyedggicnatnditldgdcyiyeirfdgvnfpangpvmqkrtvkwepstenly
    vrdgvlkgdvnmalsleggghyrcdfkttykakkvvqlpdyhfvdhhieikshdkdysnv
    nlhehaeahselprqak
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emqE (E:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    cygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepstenlyvrdgvlkgdvnmalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4emqF (F:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdpmsvikpdmkiklrmegavnghpfaieg
    vglgkpfegkqsmdlkvkeggplpfaydilttvfcygnrvfakypenivdyfkqsfpegy
    swersmnyedggicnatnditldgdcyiyeirfdgvnfpangpvmqkrtvkwepstenly
    vrdgvlkgdvnmalsleggghyrcdfkttykakkvvqlpdyhfvdhhieikshdkdysnv
    nlhehaeahselprqak
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emqF (F:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    cygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepstenlyvrdgvlkgdvnmalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahs