PDB entry 4emh

View 4emh on RCSB PDB site
Description: Crystal structure of SpLsm4
Class: RNA binding protein
Keywords: Sm fold, mRNA decay, pre-mRNA splicing, Lsm proteins, RNA BINDING PROTEIN
Deposited on 2012-04-12, released 2012-06-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-06-13, with a file datestamp of 2012-06-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.238
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable U6 snRNA-associated Sm-like protein LSm4
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm4, SPBC30D10.06
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4emha_
  • Chain 'B':
    Compound: Probable U6 snRNA-associated Sm-like protein LSm4
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm4, SPBC30D10.06
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4emhb_
  • Chain 'C':
    Compound: Probable U6 snRNA-associated Sm-like protein LSm4
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm4, SPBC30D10.06
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4emhc_
  • Chain 'D':
    Compound: Probable U6 snRNA-associated Sm-like protein LSm4
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm4, SPBC30D10.06
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4emhd_
  • Chain 'E':
    Compound: Probable U6 snRNA-associated Sm-like protein LSm4
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm4, SPBC30D10.06
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4emhe_
  • Chain 'F':
    Compound: Probable U6 snRNA-associated Sm-like protein LSm4
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm4, SPBC30D10.06
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4emhf_
  • Chain 'G':
    Compound: Probable U6 snRNA-associated Sm-like protein LSm4
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm4, SPBC30D10.06
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4emhg_
  • Chain 'H':
    Compound: Probable U6 snRNA-associated Sm-like protein LSm4
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm4, SPBC30D10.06
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4emhh_
  • Chain 'I':
    Compound: Probable U6 snRNA-associated Sm-like protein LSm4
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm4, SPBC30D10.06
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4emhi_
  • Chain 'J':
    Compound: Probable U6 snRNA-associated Sm-like protein LSm4
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm4, SPBC30D10.06
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4emhj_
  • Chain 'K':
    Compound: Probable U6 snRNA-associated Sm-like protein LSm4
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm4, SPBC30D10.06
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4emhk_
  • Chain 'L':
    Compound: Probable U6 snRNA-associated Sm-like protein LSm4
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm4, SPBC30D10.06
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4emhl_
  • Chain 'M':
    Compound: Probable U6 snRNA-associated Sm-like protein LSm4
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm4, SPBC30D10.06
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4emhm_
  • Chain 'N':
    Compound: Probable U6 snRNA-associated Sm-like protein LSm4
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm4, SPBC30D10.06
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4emhn_
  • Chain 'O':
    Compound: Probable U6 snRNA-associated Sm-like protein LSm4
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm4, SPBC30D10.06
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4emho_
  • Chain 'P':
    Compound: Probable U6 snRNA-associated Sm-like protein LSm4
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm4, SPBC30D10.06
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4emhp_
  • Chain 'Q':
    Compound: Probable U6 snRNA-associated Sm-like protein LSm4
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm4, SPBC30D10.06
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4emhq_
  • Chain 'R':
    Compound: Probable U6 snRNA-associated Sm-like protein LSm4
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm4, SPBC30D10.06
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4emhr_
  • Chain 'T':
    Compound: Probable U6 snRNA-associated Sm-like protein LSm4
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm4, SPBC30D10.06
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4emht_
  • Chain 'U':
    Compound: Probable U6 snRNA-associated Sm-like protein LSm4
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm4, SPBC30D10.06
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4emhu_
  • Chain 'V':
    Compound: Probable U6 snRNA-associated Sm-like protein LSm4
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm4, SPBC30D10.06
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4emhv_
  • Chain 'W':
    Compound: Probable U6 snRNA-associated Sm-like protein LSm4
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm4, SPBC30D10.06
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4emhw_
  • Chain 'X':
    Compound: Probable U6 snRNA-associated Sm-like protein LSm4
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm4, SPBC30D10.06
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4emhx_
  • Chain 'Y':
    Compound: Probable U6 snRNA-associated Sm-like protein LSm4
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm4, SPBC30D10.06
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4emhy_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4emhA (A:)
    mgsshhhhhhsqdpmlpltllnatqgrpilvelkngetfnghlencdnymnltlrevirt
    mpdgdkffrlpecyirgnnikylriqdevlsqvakqqaqqrenrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emhA (A:)
    grpilvelkngetfnghlencdnymnltlrevirtmpdgdkffrlpecyirgnnikylri
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4emhB (B:)
    mgsshhhhhhsqdpmlpltllnatqgrpilvelkngetfnghlencdnymnltlrevirt
    mpdgdkffrlpecyirgnnikylriqdevlsqvakqqaqqrenrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emhB (B:)
    grpilvelkngetfnghlencdnymnltlrevirtmpdgdkffrlpecyirgnnikylri
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4emhC (C:)
    mgsshhhhhhsqdpmlpltllnatqgrpilvelkngetfnghlencdnymnltlrevirt
    mpdgdkffrlpecyirgnnikylriqdevlsqvakqqaqqrenrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emhC (C:)
    grpilvelkngetfnghlencdnymnltlrevirtmpdgdkffrlpecyirgnnikylri
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4emhD (D:)
    mgsshhhhhhsqdpmlpltllnatqgrpilvelkngetfnghlencdnymnltlrevirt
    mpdgdkffrlpecyirgnnikylriqdevlsqvakqqaqqrenrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emhD (D:)
    grpilvelkngetfnghlencdnymnltlrevirtmpdgdkffrlpecyirgnnikylri
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4emhE (E:)
    mgsshhhhhhsqdpmlpltllnatqgrpilvelkngetfnghlencdnymnltlrevirt
    mpdgdkffrlpecyirgnnikylriqdevlsqvakqqaqqrenrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emhE (E:)
    grpilvelkngetfnghlencdnymnltlrevirtmpdgdkffrlpecyirgnnikylri
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4emhF (F:)
    mgsshhhhhhsqdpmlpltllnatqgrpilvelkngetfnghlencdnymnltlrevirt
    mpdgdkffrlpecyirgnnikylriqdevlsqvakqqaqqrenrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emhF (F:)
    grpilvelkngetfnghlencdnymnltlrevirtmpdgdkffrlpecyirgnnikylri
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4emhG (G:)
    mgsshhhhhhsqdpmlpltllnatqgrpilvelkngetfnghlencdnymnltlrevirt
    mpdgdkffrlpecyirgnnikylriqdevlsqvakqqaqqrenrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emhG (G:)
    grpilvelkngetfnghlencdnymnltlrevirtmpdgdkffrlpecyirgnnikylri
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4emhH (H:)
    mgsshhhhhhsqdpmlpltllnatqgrpilvelkngetfnghlencdnymnltlrevirt
    mpdgdkffrlpecyirgnnikylriqdevlsqvakqqaqqrenrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emhH (H:)
    grpilvelkngetfnghlencdnymnltlrevirtmpdgdkffrlpecyirgnnikylri
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4emhI (I:)
    mgsshhhhhhsqdpmlpltllnatqgrpilvelkngetfnghlencdnymnltlrevirt
    mpdgdkffrlpecyirgnnikylriqdevlsqvakqqaqqrenrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emhI (I:)
    grpilvelkngetfnghlencdnymnltlrevirtmpdgdkffrlpecyirgnnikylri
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4emhJ (J:)
    mgsshhhhhhsqdpmlpltllnatqgrpilvelkngetfnghlencdnymnltlrevirt
    mpdgdkffrlpecyirgnnikylriqdevlsqvakqqaqqrenrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emhJ (J:)
    grpilvelkngetfnghlencdnymnltlrevirtmpdgdkffrlpecyirgnnikylri
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4emhK (K:)
    mgsshhhhhhsqdpmlpltllnatqgrpilvelkngetfnghlencdnymnltlrevirt
    mpdgdkffrlpecyirgnnikylriqdevlsqvakqqaqqrenrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emhK (K:)
    grpilvelkngetfnghlencdnymnltlrevirtmpdgdkffrlpecyirgnnikylri
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4emhL (L:)
    mgsshhhhhhsqdpmlpltllnatqgrpilvelkngetfnghlencdnymnltlrevirt
    mpdgdkffrlpecyirgnnikylriqdevlsqvakqqaqqrenrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emhL (L:)
    grpilvelkngetfnghlencdnymnltlrevirtmpdgdkffrlpecyirgnnikylri
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4emhM (M:)
    mgsshhhhhhsqdpmlpltllnatqgrpilvelkngetfnghlencdnymnltlrevirt
    mpdgdkffrlpecyirgnnikylriqdevlsqvakqqaqqrenrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emhM (M:)
    grpilvelkngetfnghlencdnymnltlrevirtmpdgdkffrlpecyirgnnikylri
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4emhN (N:)
    mgsshhhhhhsqdpmlpltllnatqgrpilvelkngetfnghlencdnymnltlrevirt
    mpdgdkffrlpecyirgnnikylriqdevlsqvakqqaqqrenrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emhN (N:)
    grpilvelkngetfnghlencdnymnltlrevirtmpdgdkffrlpecyirgnnikylri
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >4emhO (O:)
    mgsshhhhhhsqdpmlpltllnatqgrpilvelkngetfnghlencdnymnltlrevirt
    mpdgdkffrlpecyirgnnikylriqdevlsqvakqqaqqrenrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emhO (O:)
    grpilvelkngetfnghlencdnymnltlrevirtmpdgdkffrlpecyirgnnikylri
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >4emhP (P:)
    mgsshhhhhhsqdpmlpltllnatqgrpilvelkngetfnghlencdnymnltlrevirt
    mpdgdkffrlpecyirgnnikylriqdevlsqvakqqaqqrenrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emhP (P:)
    grpilvelkngetfnghlencdnymnltlrevirtmpdgdkffrlpecyirgnnikylri
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >4emhQ (Q:)
    mgsshhhhhhsqdpmlpltllnatqgrpilvelkngetfnghlencdnymnltlrevirt
    mpdgdkffrlpecyirgnnikylriqdevlsqvakqqaqqrenrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emhQ (Q:)
    grpilvelkngetfnghlencdnymnltlrevirtmpdgdkffrlpecyirgnnikylri
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >4emhR (R:)
    mgsshhhhhhsqdpmlpltllnatqgrpilvelkngetfnghlencdnymnltlrevirt
    mpdgdkffrlpecyirgnnikylriqdevlsqvakqqaqqrenrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emhR (R:)
    grpilvelkngetfnghlencdnymnltlrevirtmpdgdkffrlpecyirgnnikylri
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >4emhT (T:)
    mgsshhhhhhsqdpmlpltllnatqgrpilvelkngetfnghlencdnymnltlrevirt
    mpdgdkffrlpecyirgnnikylriqdevlsqvakqqaqqrenrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emhT (T:)
    grpilvelkngetfnghlencdnymnltlrevirtmpdgdkffrlpecyirgnnikylri
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >4emhU (U:)
    mgsshhhhhhsqdpmlpltllnatqgrpilvelkngetfnghlencdnymnltlrevirt
    mpdgdkffrlpecyirgnnikylriqdevlsqvakqqaqqrenrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emhU (U:)
    grpilvelkngetfnghlencdnymnltlrevirtmpdgdkffrlpecyirgnnikylri
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >4emhV (V:)
    mgsshhhhhhsqdpmlpltllnatqgrpilvelkngetfnghlencdnymnltlrevirt
    mpdgdkffrlpecyirgnnikylriqdevlsqvakqqaqqrenrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emhV (V:)
    grpilvelkngetfnghlencdnymnltlrevirtmpdgdkffrlpecyirgnnikylri
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >4emhW (W:)
    mgsshhhhhhsqdpmlpltllnatqgrpilvelkngetfnghlencdnymnltlrevirt
    mpdgdkffrlpecyirgnnikylriqdevlsqvakqqaqqrenrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emhW (W:)
    grpilvelkngetfnghlencdnymnltlrevirtmpdgdkffrlpecyirgnnikylri
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >4emhX (X:)
    mgsshhhhhhsqdpmlpltllnatqgrpilvelkngetfnghlencdnymnltlrevirt
    mpdgdkffrlpecyirgnnikylriqdevlsqvakqqaqqrenrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emhX (X:)
    grpilvelkngetfnghlencdnymnltlrevirtmpdgdkffrlpecyirgnnikylri
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >4emhY (Y:)
    mgsshhhhhhsqdpmlpltllnatqgrpilvelkngetfnghlencdnymnltlrevirt
    mpdgdkffrlpecyirgnnikylriqdevlsqvakqqaqqrenrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emhY (Y:)
    grpilvelkngetfnghlencdnymnltlrevirtmpdgdkffrlpecyirgnnikylri