PDB entry 4elw

View 4elw on RCSB PDB site
Description: Structure of E. coli. 1,4-dihydroxy-2- naphthoyl coenzyme A synthases (MENB) in complex with nitrate
Class: lyase
Keywords: Dihydroxynaphthoic acid synthetase, LYASE
Deposited on 2012-04-11, released 2012-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-07-03, with a file datestamp of 2013-06-28.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.175
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1,4-Dihydroxy-2-naphthoyl-CoA synthase
    Species: Escherichia coli [TaxId:83333]
    Gene: menB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4elwa_
  • Chain 'B':
    Compound: 1,4-Dihydroxy-2-naphthoyl-CoA synthase
    Species: Escherichia coli [TaxId:83333]
    Gene: menB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4elwb_
  • Chain 'C':
    Compound: 1,4-Dihydroxy-2-naphthoyl-CoA synthase
    Species: Escherichia coli [TaxId:83333]
    Gene: menB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4elwc_
  • Chain 'D':
    Compound: 1,4-Dihydroxy-2-naphthoyl-CoA synthase
    Species: Escherichia coli [TaxId:83333]
    Gene: menB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4elwd_
  • Chain 'E':
    Compound: 1,4-Dihydroxy-2-naphthoyl-CoA synthase
    Species: Escherichia coli [TaxId:83333]
    Gene: menB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4elwe_
  • Chain 'F':
    Compound: 1,4-Dihydroxy-2-naphthoyl-CoA synthase
    Species: Escherichia coli [TaxId:83333]
    Gene: menB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4elwf_
  • Heterogens: NO3, SIN, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4elwA (A:)
    miypdeamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkemiqal
    adaryddnigviiltgagdkafcsggdqkvrgdyggykddsgvhhlnvldfqrqirtcpk
    pvvamvagysiggghvlhmmcdltiaadnaifgqtgpkvgsfdggwgasymarivgqkka
    reiwflcrqydakqaldmglvntvvpladleketvrwcremlqnspmalrclkaalnadc
    dgqaglqelagnatmlfymteegqegrnafnqkrqpdfskfkrnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4elwA (A:)
    pdeamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkemiqalada
    ryddnigviiltgagdkafcsggdqkhlnvldfqrqirtcpkpvvamvagysiggghvlh
    mmcdltiaadnaifgqtgpkvgsfdggwgasymarivgqkkareiwflcrqydakqaldm
    glvntvvpladleketvrwcremlqnspmalrclkaalnadcdgqaglqelagnatmlfy
    mteegqegrnafnqkrqpdfskfkrnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4elwB (B:)
    miypdeamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkemiqal
    adaryddnigviiltgagdkafcsggdqkvrgdyggykddsgvhhlnvldfqrqirtcpk
    pvvamvagysiggghvlhmmcdltiaadnaifgqtgpkvgsfdggwgasymarivgqkka
    reiwflcrqydakqaldmglvntvvpladleketvrwcremlqnspmalrclkaalnadc
    dgqaglqelagnatmlfymteegqegrnafnqkrqpdfskfkrnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4elwB (B:)
    deamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkemiqaladar
    yddnigviiltgagdkafcsggdqkvhlnvldfqrqirtcpkpvvamvagysiggghvlh
    mmcdltiaadnaifgqtgpkvgsfdggwgasymarivgqkkareiwflcrqydakqaldm
    glvntvvpladleketvrwcremlqnspmalrclkaalnadcdgqaglqelagnatmlfy
    mteegqegrnafnqkrqpdfskfkrnp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4elwC (C:)
    miypdeamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkemiqal
    adaryddnigviiltgagdkafcsggdqkvrgdyggykddsgvhhlnvldfqrqirtcpk
    pvvamvagysiggghvlhmmcdltiaadnaifgqtgpkvgsfdggwgasymarivgqkka
    reiwflcrqydakqaldmglvntvvpladleketvrwcremlqnspmalrclkaalnadc
    dgqaglqelagnatmlfymteegqegrnafnqkrqpdfskfkrnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4elwC (C:)
    deamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkemiqaladar
    yddnigviiltgagdkafcsgghhlnvldfqrqirtcpkpvvamvagysiggghvlhmmc
    dltiaadnaifgqtgpkvgsfdggwgasymarivgqkkareiwflcrqydakqaldmglv
    ntvvpladleketvrwcremlqnspmalrclkaalnadcdgqaglqelagnatmlfymte
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4elwD (D:)
    miypdeamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkemiqal
    adaryddnigviiltgagdkafcsggdqkvrgdyggykddsgvhhlnvldfqrqirtcpk
    pvvamvagysiggghvlhmmcdltiaadnaifgqtgpkvgsfdggwgasymarivgqkka
    reiwflcrqydakqaldmglvntvvpladleketvrwcremlqnspmalrclkaalnadc
    dgqaglqelagnatmlfymteegqegrnafnqkrqpdfskfkrnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4elwD (D:)
    pdeamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkemiqalada
    ryddnigviiltgagdkafcsggdqlnvldfqrqirtcpkpvvamvagysiggghvlhmm
    cdltiaadnaifgqtgpkvgsfdggwgasymarivgqkkareiwflcrqydakqaldmgl
    vntvvpladleketvrwcremlqnspmalrclkaalnadcdgqaglqelagnatmlfymt
    eegqegrnafnqkrqpdfskfkrnp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4elwE (E:)
    miypdeamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkemiqal
    adaryddnigviiltgagdkafcsggdqkvrgdyggykddsgvhhlnvldfqrqirtcpk
    pvvamvagysiggghvlhmmcdltiaadnaifgqtgpkvgsfdggwgasymarivgqkka
    reiwflcrqydakqaldmglvntvvpladleketvrwcremlqnspmalrclkaalnadc
    dgqaglqelagnatmlfymteegqegrnafnqkrqpdfskfkrnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4elwE (E:)
    deamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkemiqaladar
    yddnigviiltgagdkafcsggdvhhlnvldfqrqirtcpkpvvamvagysiggghvlhm
    mcdltiaadnaifgqtgpkvgsfdggwgasymarivgqkkareiwflcrqydakqaldmg
    lvntvvpladleketvrwcremlqnspmalrclkaalnadcdgqaglqelagnatmlfym
    teegqegrnapdfskfkrnp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4elwF (F:)
    miypdeamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkemiqal
    adaryddnigviiltgagdkafcsggdqkvrgdyggykddsgvhhlnvldfqrqirtcpk
    pvvamvagysiggghvlhmmcdltiaadnaifgqtgpkvgsfdggwgasymarivgqkka
    reiwflcrqydakqaldmglvntvvpladleketvrwcremlqnspmalrclkaalnadc
    dgqaglqelagnatmlfymteegqegrnafnqkrqpdfskfkrnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4elwF (F:)
    pdeamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkemiqalada
    ryddnigviiltgagdkafcsggdlnvldfqrqirtcpkpvvamvagysiggghvlhmmc
    dltiaadnaifgqtgpkvgsfdggwgasymarivgqkkareiwflcrqydakqaldmglv
    ntvvpladleketvrwcremlqnspmalrclkaalnadcdgqaglqelagnatmlfymte
    egqegrnrqpdfskfkrnp