PDB entry 4els

View 4els on RCSB PDB site
Description: Structure of E. Coli. 1,4-dihydroxy-2- naphthoyl coenzyme A synthases (MENB) in complex with bicarbonate
Class: lyase
Keywords: dihydroxynaphthoic acid synthetase, LYASE
Deposited on 2012-04-11, released 2012-06-06
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-07-03, with a file datestamp of 2013-06-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.184
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1,4-Dihydroxy-2-naphthoyl-CoA synthase
    Species: Escherichia coli [TaxId:83333]
    Gene: menB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4elsa_
  • Chain 'B':
    Compound: 1,4-Dihydroxy-2-naphthoyl-CoA synthase
    Species: Escherichia coli [TaxId:83333]
    Gene: menB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4elsb_
  • Chain 'C':
    Compound: 1,4-Dihydroxy-2-naphthoyl-CoA synthase
    Species: Escherichia coli [TaxId:83333]
    Gene: menB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4elsc_
  • Chain 'D':
    Compound: 1,4-Dihydroxy-2-naphthoyl-CoA synthase
    Species: Escherichia coli [TaxId:83333]
    Gene: menB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4elsd_
  • Chain 'E':
    Compound: 1,4-Dihydroxy-2-naphthoyl-CoA synthase
    Species: Escherichia coli [TaxId:83333]
    Gene: menB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4else_
  • Chain 'F':
    Compound: 1,4-Dihydroxy-2-naphthoyl-CoA synthase
    Species: Escherichia coli [TaxId:83333]
    Gene: menB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4elsf_
  • Heterogens: BCT, GOL, EDO, CL, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4elsA (A:)
    miypdeamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkemiqal
    adaryddnigviiltgagdkafcsggdqkvrgdyggykddsgvhhlnvldfqrqirtcpk
    pvvamvagysiggghvlhmmcdltiaadnaifgqtgpkvgsfdggwgasymarivgqkka
    reiwflcrqydakqaldmglvntvvpladleketvrwcremlqnspmalrclkaalnadc
    dgqaglqelagnatmlfymteegqegrnafnqkrqpdfskfkrnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4elsA (A:)
    pdeamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkemiqalada
    ryddnigviiltgagdkafcsggdqkhlnvldfqrqirtcpkpvvamvagysiggghvlh
    mmcdltiaadnaifgqtgpkvgsfdggwgasymarivgqkkareiwflcrqydakqaldm
    glvntvvpladleketvrwcremlqnspmalrclkaalnadcdgqaglqelagnatmlfy
    mteegqegrnafnqkrqpdfskfkrnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4elsB (B:)
    miypdeamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkemiqal
    adaryddnigviiltgagdkafcsggdqkvrgdyggykddsgvhhlnvldfqrqirtcpk
    pvvamvagysiggghvlhmmcdltiaadnaifgqtgpkvgsfdggwgasymarivgqkka
    reiwflcrqydakqaldmglvntvvpladleketvrwcremlqnspmalrclkaalnadc
    dgqaglqelagnatmlfymteegqegrnafnqkrqpdfskfkrnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4elsB (B:)
    pdeamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkemiqalada
    ryddnigviiltgagdkafcsggdqkvhlnvldfqrqirtcpkpvvamvagysiggghvl
    hmmcdltiaadnaifgqtgpkvgsfdggwgasymarivgqkkareiwflcrqydakqald
    mglvntvvpladleketvrwcremlqnspmalrclkaalnadcdgqaglqelagnatmlf
    ymteegqegrnafnqkrqpdfskfkrnp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4elsC (C:)
    miypdeamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkemiqal
    adaryddnigviiltgagdkafcsggdqkvrgdyggykddsgvhhlnvldfqrqirtcpk
    pvvamvagysiggghvlhmmcdltiaadnaifgqtgpkvgsfdggwgasymarivgqkka
    reiwflcrqydakqaldmglvntvvpladleketvrwcremlqnspmalrclkaalnadc
    dgqaglqelagnatmlfymteegqegrnafnqkrqpdfskfkrnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4elsC (C:)
    pdeamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkemiqalada
    ryddnigviiltgagdkafcsgghlnvldfqrqirtcpkpvvamvagysiggghvlhmmc
    dltiaadnaifgqtgpkvgsfdggwgasymarivgqkkareiwflcrqydakqaldmglv
    ntvvpladleketvrwcremlqnspmalrclkaalnadcdgqaglqelagnatmlfymte
    e
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4elsD (D:)
    miypdeamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkemiqal
    adaryddnigviiltgagdkafcsggdqkvrgdyggykddsgvhhlnvldfqrqirtcpk
    pvvamvagysiggghvlhmmcdltiaadnaifgqtgpkvgsfdggwgasymarivgqkka
    reiwflcrqydakqaldmglvntvvpladleketvrwcremlqnspmalrclkaalnadc
    dgqaglqelagnatmlfymteegqegrnafnqkrqpdfskfkrnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4elsD (D:)
    pdeamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkemiqalada
    ryddnigviiltgagdkafcsggdqlnvldfqrqirtcpkpvvamvagysiggghvlhmm
    cdltiaadnaifgqtgpkvgsfdggwgasymarivgqkkareiwflcrqydakqaldmgl
    vntvvpladleketvrwcremlqnspmalrclkaalnadcdgqaglqelagnatmlfymt
    eegqegrnafnqkrqpdfskfkrnp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4elsE (E:)
    miypdeamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkemiqal
    adaryddnigviiltgagdkafcsggdqkvrgdyggykddsgvhhlnvldfqrqirtcpk
    pvvamvagysiggghvlhmmcdltiaadnaifgqtgpkvgsfdggwgasymarivgqkka
    reiwflcrqydakqaldmglvntvvpladleketvrwcremlqnspmalrclkaalnadc
    dgqaglqelagnatmlfymteegqegrnafnqkrqpdfskfkrnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4elsE (E:)
    deamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkemiqaladar
    yddnigviiltgagdkafcsggdvhhlnvldfqrqirtcpkpvvamvagysiggghvlhm
    mcdltiaadnaifgqtgpkvgsfdggwgasymarivgqkkareiwflcrqydakqaldmg
    lvntvvpladleketvrwcremlqnspmalrclkaalnadcdgqaglqelagnatmlfym
    teegqegrnafnqkrqpdfskfkrnp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4elsF (F:)
    miypdeamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkemiqal
    adaryddnigviiltgagdkafcsggdqkvrgdyggykddsgvhhlnvldfqrqirtcpk
    pvvamvagysiggghvlhmmcdltiaadnaifgqtgpkvgsfdggwgasymarivgqkka
    reiwflcrqydakqaldmglvntvvpladleketvrwcremlqnspmalrclkaalnadc
    dgqaglqelagnatmlfymteegqegrnafnqkrqpdfskfkrnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4elsF (F:)
    deamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkemiqaladar
    yddnigviiltgagdkafcsggdqlnvldfqrqirtcpkpvvamvagysiggghvlhmmc
    dltiaadnaifgqtgpkvgsfdggwgasymarivgqkkareiwflcrqydakqaldmglv
    ntvvpladleketvrwcremlqnspmalrclkaalnadcdgqaglqelagnatmlfymte
    egqegrnafnqkrqpdfskfkrnp